DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rdo and 18w

Sequence 1:NP_001286024.1 Gene:rdo FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster

Alignment Length:847 Identity:188/848 (22%)
Similarity:308/848 (36%) Gaps:220/848 (26%)


  Fly    19 NTKRKCPTECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDVKVIIIRGPRNSITIGPALRQF-- 81
            |..|:.|....|||..|..         ||  |:.|.    ::.....|....:..|.||...  
  Fly   155 NNIRQLPEGVWCSMPSLQL---------LN--LTQNR----IRSAEFLGFSEKLCAGSALSNANG 204

  Fly    82 -----MKLEILRITDSNLPAIGAESFWG---LKYLRILDLSKNNITNITENNFRGQDNLLELDLS 138
                 .:|:.|.::.:.|.::  ...||   |:.|:.|.|..|||:.:..|...|..:|..|::|
  Fly   205 AVSGGSELQTLDVSFNELRSL--PDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNIS 267

  Fly   139 KNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQDLQPD--VFRDV 201
            .|.::.:.|..|....:||.|:|..|.:.||.:.....|.:|..||||||.|.....|  .|..:
  Fly   268 YNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGL 332

  Fly   202 PELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVV 266
            ..|.||...|..|.:|..:.:..|..|..||:..|....:::..|..:..|..:.|..|:|..:.
  Fly   333 IRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLD 397

  Fly   267 DQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISG 331
            :::|.....|..|.|:.|.::.|.:.:|...::|..||||.|:|..: |::::.||.|.||::..
  Fly   398 NRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEV-PEAVQDLSMLKTLDLGE 461

  Fly   332 NVLMDLREMRETFEPLIYYFFLTCSKLFFQLIPQLTHLAIAD--MGTMPVGLLHPFKQLRYLNIS 394
            |.:.:.:  ..||..|                .|||.|.:.|  :|.:.||:.....:|..||::
  Fly   462 NQISEFK--NNTFRNL----------------NQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLA 508

  Fly   395 GNSLNNTALEVIDPCRELEFLDLSRNQLHGISEDTVLRIQGIRNVRLDNNPLICDECHMGKLINV 459
            .|.:.:......|...|:|.:.|.:|.|..|: .....:..:..:.|..|.|:            
  Fly   509 KNRIQSIERGAFDKNTEIEAIRLDKNFLTDIN-GIFATLASLLWLNLSENHLV------------ 560

  Fly   460 VRQLQWKWDTYPICFLPKSLRGAEINNLDINGLHTCLTFITDEEQNAASTSYNFLEHGGLNTLAI 524
                   |..|  .|:|.:|:.     |||:|                    |::|        .
  Fly   561 -------WFDY--AFIPSNLKW-----LDIHG--------------------NYIE--------A 583

  Fly   525 LGGIIFVLIAVIILSLVACFSKNRARYYTREDHLNGSESKCLEKNLEATTITTLGNGSSPTTTTT 589
            ||....:...:.:.:|.|  |.||..........|..|...:..|:       :|...:.|....
  Fly   584 LGNYYKLQEEIRVTTLDA--SHNRITEIGAMSVPNSIELLFINNNI-------IGQIQANTFVDK 639

  Fly   590 LTLATSPAAPNG-PKTNGQGLSLSPANGSTPVHGISDDKGKEINF---TFPVDDRVCTIDELMPS 650
            ..||......|. .|.:...|.::|.:...||        .|...   .|..|   |:::.|...
  Fly   640 TRLARVDLYANVLSKISLNALRVAPVSAEKPV--------PEFYLGGNPFECD---CSMEWLQRI 693

  Fly   651 PPPPPQQHPH-PNMGSLMYSVSHSPNS-ATTLAAVAAA-----------------------ATVI 690
            .....:|||| .::|::...:.||.:: ...||:::|:                       ..||
  Fly   694 NNLTTRQHPHVVDLGNIECLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVI 758

  Fly   691 PPGAPS--HSS--------------MPTPTPTPAEAVVVVLPPPPLPPQQHHH------------ 727
            .||..|  |.:              ...|...|.:...:.|....:|..:..|            
  Fly   759 CPGNCSCFHDATWATNIVDCGRQDLAALPNRIPQDVSDLYLDGNNMPELEVGHLTGRRNLRALYL 823

  Fly   728 -------QMDGSLAS---------------------------LREV---QQQLVHLS-STLEPLV 754
                   ..:||||.                           |||:   ...|.|:| :|.||||
  Fly   824 NASNLMTLQNGSLAQLVNLRVLHLENNKLTALEGTEFRSLGLLRELYLHNNMLTHISNATFEPLV 888

  Fly   755 SV 756
            |:
  Fly   889 SL 890

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 6/26 (23%)
leucine-rich repeat 108..131 CDD:275380 8/23 (35%)
LRR_8 131..190 CDD:290566 21/59 (36%)
leucine-rich repeat 132..155 CDD:275380 6/23 (26%)
LRR_RI 151..422 CDD:238064 75/275 (27%)
leucine-rich repeat 156..179 CDD:275380 8/23 (35%)
LRR_8 178..262 CDD:290566 25/86 (29%)
leucine-rich repeat 180..203 CDD:275380 10/25 (40%)
leucine-rich repeat 204..251 CDD:275380 12/47 (26%)
leucine-rich repeat 252..275 CDD:275380 5/23 (22%)
LRR_8 274..334 CDD:290566 20/60 (33%)
leucine-rich repeat 276..299 CDD:275380 6/23 (26%)
LRR_4 298..342 CDD:289563 14/44 (32%)
leucine-rich repeat 300..323 CDD:275380 10/23 (43%)
leucine-rich repeat 388..411 CDD:275380 5/23 (22%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 11/41 (27%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380 6/15 (40%)
leucine-rich repeat 171..201 CDD:275380 9/45 (20%)
LRR_RI 210..464 CDD:238064 75/257 (29%)
leucine-rich repeat 212..236 CDD:275380 6/26 (23%)
LRR_8 235..295 CDD:290566 19/60 (32%)
leucine-rich repeat 237..260 CDD:275380 8/23 (35%)
leucine-rich repeat 261..284 CDD:275380 6/23 (26%)
LRR_8 283..345 CDD:290566 22/62 (35%)
leucine-rich repeat 285..308 CDD:275380 8/23 (35%)
leucine-rich repeat 309..334 CDD:275380 10/25 (40%)
LRR_8 334..393 CDD:290566 15/59 (25%)
leucine-rich repeat 335..358 CDD:275380 7/23 (30%)
leucine-rich repeat 359..382 CDD:275380 5/23 (22%)
LRR_8 382..441 CDD:290566 17/59 (29%)
leucine-rich repeat 383..406 CDD:275380 5/23 (22%)
leucine-rich repeat 407..430 CDD:275380 6/23 (26%)
LRR_8 431..488 CDD:290566 22/76 (29%)
leucine-rich repeat 431..451 CDD:275380 8/21 (38%)
leucine-rich repeat 454..477 CDD:275380 7/41 (17%)
LRR_8 477..559 CDD:290566 21/83 (25%)
leucine-rich repeat 478..499 CDD:275380 7/21 (33%)
leucine-rich repeat 502..525 CDD:275380 5/23 (22%)
leucine-rich repeat 526..548 CDD:275380 5/23 (22%)
leucine-rich repeat 590..617 CDD:275380 6/29 (21%)
leucine-rich repeat 618..641 CDD:275380 4/30 (13%)
leucine-rich repeat 642..689 CDD:275380 12/58 (21%)
LRRCT 679..736 CDD:214507 14/60 (23%)
leucine-rich repeat 775..796 CDD:275380 2/21 (10%)
LRR_8 797..852 CDD:290566 7/55 (13%)
leucine-rich repeat 797..817 CDD:275380 3/20 (15%)
leucine-rich repeat 818..841 CDD:275380 4/23 (17%)
LRR_8 841..900 CDD:290566 12/51 (24%)
leucine-rich repeat 842..865 CDD:275380 0/23 (0%)
LRR_4 866..907 CDD:289563 12/26 (46%)
leucine-rich repeat 866..889 CDD:275380 11/23 (48%)
leucine-rich repeat 890..911 CDD:275380 0/2 (0%)
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19498841
eggNOG 1 0.900 E2759_KOG4641
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.