DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15147 and AT4G31360

Sequence 1:NP_609854.1 Gene:CG15147 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_194864.2 Gene:AT4G31360 AraportID:AT4G31360 Length:186 Species:Arabidopsis thaliana

Alignment Length:59 Identity:17/60 (28%)
Similarity:28/60 (47%) Gaps:7/60 (12%)


  Fly     8 DPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEV 66
            ||.:..:.|:||:....::.||:    .:.|||....|.|.:.|   :...|..|.||:
plant    97 DPTRTKIVIEHCKQCNAFKTRAI----QVKEALEGAVPGVTVSL---NPEKPRRGCFEI 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
AT4G31360NP_194864.2 Rdx 103..183 CDD:294841 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR33638
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.