DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15147 and AT2G24440

Sequence 1:NP_609854.1 Gene:CG15147 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_565570.1 Gene:AT2G24440 AraportID:AT2G24440 Length:183 Species:Arabidopsis thaliana

Alignment Length:53 Identity:16/54 (30%)
Similarity:27/54 (50%) Gaps:7/54 (13%)


  Fly    14 LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEV 66
            :.|:||:..:::::||..:...|.||:..|...|.     .||  |..|.||:
plant   100 IVIEHCKQCKSFKERANEVKEGLEEAVPGIIVTVN-----PDK--PRRGCFEI 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
AT2G24440NP_565570.1 Rdx 100..>146 CDD:294841 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR33638
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.