DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15147 and AT2G24440

DIOPT Version :10

Sequence 1:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_565570.1 Gene:AT2G24440 / 816980 AraportID:AT2G24440 Length:183 Species:Arabidopsis thaliana


Alignment Length:53 Identity:16/53 - (30%)
Similarity:27/53 - (50%) Gaps:7/53 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEV 66
            :.|:||:..:::::||..:...|.||:..|...|.     .||  |..|.||:
plant   100 IVIEHCKQCKSFKERANEVKEGLEEAVPGIIVTVN-----PDK--PRRGCFEI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
AT2G24440NP_565570.1 Rdx 100..>146 CDD:470191 16/53 (30%)

Return to query results.
Submit another query.