DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15147 and AT2G24440

DIOPT Version :9

Sequence 1:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_565570.1 Gene:AT2G24440 / 816980 AraportID:AT2G24440 Length:183 Species:Arabidopsis thaliana


Alignment Length:53 Identity:16/53 - (30%)
Similarity:27/53 - (50%) Gaps:7/53 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEV 66
            :.|:||:..:::::||..:...|.||:..|...|.     .||  |..|.||:
plant   100 IVIEHCKQCKSFKERANEVKEGLEEAVPGIIVTVN-----PDK--PRRGCFEI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
AT2G24440NP_565570.1 Rdx 100..>146 CDD:412883 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33638
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.