powered by:
Protein Alignment CG15147 and AT2G24440
DIOPT Version :9
Sequence 1: | NP_609854.1 |
Gene: | CG15147 / 35069 |
FlyBaseID: | FBgn0032654 |
Length: | 146 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_565570.1 |
Gene: | AT2G24440 / 816980 |
AraportID: | AT2G24440 |
Length: | 183 |
Species: | Arabidopsis thaliana |
Alignment Length: | 53 |
Identity: | 16/53 - (30%) |
Similarity: | 27/53 - (50%) |
Gaps: | 7/53 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEV 66
:.|:||:..:::::||..:...|.||:..|...|. .|| |..|.||:
plant 100 IVIEHCKQCKSFKERANEVKEGLEEAVPGIIVTVN-----PDK--PRRGCFEI 145
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15147 | NP_609854.1 |
None |
AT2G24440 | NP_565570.1 |
Rdx |
100..>146 |
CDD:412883 |
16/53 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0008474 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR33638 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.100 |
|
Return to query results.
Submit another query.