powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG15147 and AT2G24440
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_609854.1 | 
            Gene: | CG15147 / 35069 | 
            FlyBaseID: | FBgn0032654 | 
            Length: | 146 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_565570.1 | 
            Gene: | AT2G24440 / 816980 | 
            AraportID: | AT2G24440 | 
            Length: | 183 | 
            Species: | Arabidopsis thaliana | 
          
        
        
        
          
            | Alignment Length: | 53 | 
            Identity: | 16/53 - (30%) | 
          
          
            | Similarity: | 27/53 -  (50%) | 
            Gaps: | 7/53 - (13%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    14 LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEV 66 
            :.|:||:..:::::||..:...|.||:..|...|.     .||  |..|.||: 
plant   100 IVIEHCKQCKSFKERANEVKEGLEEAVPGIIVTVN-----PDK--PRRGCFEI 145 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | 
            External ID | Identity | 
          
          
            | CG15147 | NP_609854.1 | 
            None | 
          
          
            | AT2G24440 | NP_565570.1 | 
            Rdx | 
            100..>146 | 
            CDD:412883 | 
            16/53 (30%) | 
          
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            FOG0008474 | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            O | 
            PTHR33638 | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            2 | 2.100 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.