DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15147 and Selenoh

DIOPT Version :9

Sequence 1:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001028338.1 Gene:Selenoh / 72657 MGIID:1919907 Length:116 Species:Mus musculus


Alignment Length:101 Identity:28/101 - (27%)
Similarity:51/101 - (50%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKRPLDPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEVA 67
            |||........:.|:||...:.|.:.|    ::|::||:...|.:.:|:   :...|..|||||.
Mouse    19 DKREKLAEGATVVIEHCTSURVYGRHA----AALSQALQLEAPELPVQV---NPSKPRRGSFEVT 76

  Fly    68 IAPQPTDDSTARQSVWTGLRRMPSAS-KVPHVDDIL 102
            :.  .:|:|  |..:|||:::.|... |.|...:::
Mouse    77 LL--RSDNS--RVELWTGIKKGPPRKLKFPEPQEVV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
SelenohNP_001028338.1 Rdx 30..113 CDD:294841 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.