DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15147 and Selenoh

Sequence 1:NP_609854.1 Gene:CG15147 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001108411.1 Gene:Selenoh RGDID:1563348 Length:116 Species:Rattus norvegicus

Alignment Length:101 Identity:29/102 (28%)
Similarity:53/102 (52%) Gaps:12/102 (12%)


  Fly     3 DKRPLDPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEVA 67
            |||........:.|:||.. :.|.:.|    ::|::||:...|.:.:|:   ::..|..|||||.
  Rat    19 DKREKLAEGAAVVIEHCTSURVYGRHA----AALSQALQLEAPEISVQV---NRSKPRRGSFEVT 76

  Fly    68 IAPQPTDDSTARQSVWTGLRRMPSAS-KVPHVDDIL 102
            :. :| |:|  |..:|||:::.|... |.|...:::
  Rat    77 LL-RP-DNS--RVELWTGIKKGPPRKLKFPEPQEMV 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
SelenohNP_001108411.1 Rdx 30..113 CDD:294841 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR33638
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.