DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15147 and CG13186

Sequence 1:NP_609854.1 Gene:CG15147 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_610725.1 Gene:CG13186 FlyBaseID:FBgn0033680 Length:143 Species:Drosophila melanogaster

Alignment Length:127 Identity:29/128 (23%)
Similarity:50/128 (39%) Gaps:32/128 (25%)


  Fly     1 MPDKRPLDPLQPV--------------LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQL 51
            ||.|:|....:.|              :||:|......::.:|....:...:.:    |..|.||
  Fly     1 MPPKKPAKKKKDVDWSSDEHFSKDRSMIYIEHTYECPIFQTKADECGTFFTQRI----PERKFQL 61

  Fly    52 RINDKG--PPEDGSFEVAIAPQPTDDSTARQSVWTGLRRMPS---------ASKVPHVDDIL 102
            ..|..|  .|.:|:||:..:   .:..|:...:|:||.:.|.         .:.||.|:.||
  Fly    62 VKNRNGRQVPREGAFEIGFS---QNARTSEHLLWSGLEKGPPRRDKFPLDYEALVPDVNRIL 120



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1435425
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR33638
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.