DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15147 and selenoh

Sequence 1:NP_609854.1 Gene:CG15147 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_835234.2 Gene:selenoh ZFINID:ZDB-GENE-030411-2 Length:127 Species:Danio rerio

Alignment Length:96 Identity:22/97 (23%)
Similarity:48/97 (49%) Gaps:13/97 (13%)


  Fly    16 IDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGSFEVAIAPQPTDDSTARQ 80
            |:||:. :.|.:.|:.:..:||::    .|.:|:.:..::   |...|||:.:.     |.....
Zfish    42 IEHCKSURVYGRNAVVVREALADS----HPELKVMINPHN---PRRNSFEITLM-----DGERAD 94

  Fly    81 SVWTGLRRMPSAS-KVPHVDDILTPVCFALK 110
            .:|:|:::.|... |.|...:::|.:..||:
Zfish    95 VLWSGIKKGPPRKLKFPEPAEVVTALKQALE 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
selenohNP_835234.2 Rdx 40..121 CDD:294841 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR33638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.