DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15147 and BthD

DIOPT Version :9

Sequence 1:NP_609854.1 Gene:CG15147 / 35069 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_572903.3 Gene:BthD / 32317 FlyBaseID:FBgn0030501 Length:249 Species:Drosophila melanogaster


Alignment Length:136 Identity:46/136 - (33%)
Similarity:71/136 - (52%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDKR---------------PLDPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQ 50
            ||.||               .|||..||||::|||..:.:|:||..|||:|.|  |.:|   :||
  Fly     1 MPPKRNKKAEAPIAERDAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRE--RGLQ---QLQ 60

  Fly    51 LRINDKGPPEDGSFEVAIAPQPTDDSTARQ---SVWTGLRR-MPSASKVPHVDDILTPVCFALKL 111
            |::|..|.|..|:||::::.    ....:|   ::|:||:| .|.|.|.|.|:::...:...|..
  Fly    61 LQLNALGAPRRGAFELSLSA----GGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDRIVGILGD 121

  Fly   112 RDPHKE 117
            :...||
  Fly   122 QQESKE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
BthDNP_572903.3 TP53IP5 <125..>216 CDD:291976 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33638
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.