DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15147 and BthD

Sequence 1:NP_609854.1 Gene:CG15147 FlyBaseID:FBgn0032654 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_572903.3 Gene:BthD FlyBaseID:FBgn0030501 Length:249 Species:Drosophila melanogaster

Alignment Length:136 Identity:46/137 (34%)
Similarity:71/137 (52%) Gaps:28/137 (20%)


  Fly     1 MPDKR---------------PLDPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQ 50
            ||.||               .|||..||||::|||. :.:|:||..|||:|.|  |.:|   :||
  Fly     1 MPPKRNKKAEAPIAERDAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRE--RGLQ---QLQ 60

  Fly    51 LRINDKGPPEDGSFEVAIAPQPTDDSTARQ---SVWTGLRR-MPSASKVPHVDDILTPVCFALKL 111
            |::|..|.|..|:||::::.    ....:|   ::|:||:| .|.|.|.|.|:::...:...|..
  Fly    61 LQLNALGAPRRGAFELSLSA----GGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDRIVGILGD 121

  Fly   112 RDPHKE 117
            :...||
  Fly   122 QQESKE 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15147NP_609854.1 None
BthDNP_572903.3 TP53IP5 <125..>216 CDD:291976 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR33638
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.