DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCS2beta and CG7685

DIOPT Version :10

Sequence 1:NP_609844.1 Gene:GCS2beta / 35056 FlyBaseID:FBgn0032643 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_650724.1 Gene:CG7685 / 42220 FlyBaseID:FBgn0038619 Length:213 Species:Drosophila melanogaster


Alignment Length:105 Identity:51/105 - (48%)
Similarity:64/105 - (60%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GVPLAKASLYQPRAGENSWTCLDGSRTIPFSHINDDYCDC-ADGSDEPGTAACPQGQFHC-VNKG 96
            |..|.....|:|.. |..:.|||||:.|||.|:||:|||| .||||||.|.||.:|:|:| ..|.
  Fly   109 GTRLFDYDAYKPNF-EGKFRCLDGSKEIPFDHLNDNYCDCEEDGSDEPSTNACAKGRFYCRYQKR 172

  Fly    97 H-----QPVNIPSSQVQDGICDCCDGSDE-SETVGCPNTC 130
            |     ..:.:.||::.|.:||||||||| |....|||.|
  Fly   173 HITGRGLDIYVASSRINDHVCDCCDGSDEWSTATKCPNDC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCS2betaNP_609844.1 PRKCSH-like 26..193 CDD:372423 51/105 (49%)
SMC_prok_B <154..428 CDD:274008
PRKCSH 398..547 CDD:414904
CG7685NP_650724.1 PRKCSH-like 97..>213 CDD:372423 51/105 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.