DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5110 and Lamtor3

Sequence 1:NP_001246062.1 Gene:CG5110 FlyBaseID:FBgn0032642 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_064304.1 Gene:Lamtor3 MGIID:1929467 Length:124 Species:Mus musculus

Alignment Length:121 Identity:54/122 (44%)
Similarity:85/122 (70%) Gaps:0/122 (0%)


  Fly     1 MSDDIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFALMPSFIPTFTTACDQASKLGL 65
            |:||:|::|...|..|.||:.|.::||||||:::|:.:...:.||.|.|:.||..|.||.|||||
Mouse     1 MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGL 65

  Fly    66 GRNKTIISMYSNYQVVQMNKLPLILTFVGAENCNTGHILALEHQVDGYLEDIKQAV 121
            .:||:||..|:.|||||.|:|||:::|:.:.:.|||.|::||.::....|::.:.|
Mouse    66 SKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVV 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5110NP_001246062.1 MAPKK1_Int 3..121 CDD:286067 52/118 (44%)
Lamtor3NP_064304.1 MAPKK1_Int 3..121 CDD:312472 52/118 (44%)
Required for interaction with LAMTOR2. {ECO:0000269|PubMed:11266467} 57..70 9/13 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234600966
eggNOG 1 0.900 E1_2A8R2
Hieranoid 1 1.000
Homologene 1 1.000 H10539
Inparanoid 1 1.050 117 1.000 Inparanoid score I4758
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005520
OrthoInspector 1 1.000 T1084357
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13378
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4633
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.