powered by:
Protein Alignment SPH93 and mettl7a.2
DIOPT Version :9
| Sequence 1: | NP_609840.1 |
Gene: | SPH93 / 35049 |
FlyBaseID: | FBgn0032638 |
Length: | 494 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_002933742.3 |
Gene: | mettl7a.2 / 779612 |
XenbaseID: | XB-GENE-22069551 |
Length: | 244 |
Species: | Xenopus tropicalis |
| Alignment Length: | 104 |
Identity: | 24/104 - (23%) |
| Similarity: | 41/104 - (39%) |
Gaps: | 17/104 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 280 VVLTVAHRVITIETELVVRAGDWD----------LKSDREIFLSEQREVERAVIHEGFDFKSGAN 334
::|.|...|:.:...::...|.|| |:...:.:..:..:.:|.:.....||...:.
Frog 6 LLLQVCVGVVALPVHILAFLGLWDRIAKVVLPYLLERITKEYNRKMGDEKRQLFRNLSDFAGPSG 70
Fly 335 NLALLFLNSPFKLNDHI-----RTICL-PTPN-KSFAGR 366
.||:|.|......|... :..|: |.|| |||.||
Frog 71 KLAILDLGCGTGANFQYYPAGSKVTCMDPNPNFKSFLGR 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.