DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG31220

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:117/288 - (40%) Gaps:47/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PSCGMSNANGLQMVEGITIDQARPAQYPW-AVAIFHNGQYL---------AGGSLIQPNVVLTVA 285
            |.||...... :::.|   .:....:||| |:.::.|....         .|||||....|||.|
  Fly    93 PDCGKPQTTN-RVIGG---TEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAA 153

  Fly   286 HRVITIETELV-----VRAGDWDLKSDREIFLSEQR----------EVERAVIHEGFD-----FK 330
            |.|    |:.|     ||.|:.....:.:......|          :||....|..:|     |:
  Fly   154 HCV----TDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFR 214

  Fly   331 SGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVV 395
               |::||:.|..|.:.......||:....:|....:..||||||....|.. |.|||...:.|.
  Fly   215 ---NDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTG-SKVLKHAAVKVR 275

  Fly   396 NRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWG 460
            ....|.:.......|.:|:     |||||...|.||.||.||.|..:.|.....:...|||.::|
  Fly   276 KPEECSEKYAHRHFGPRFQ-----ICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYG 335

  Fly   461 VGCGQEGIPAIYTEVSKFTNWITEKLLP 488
            ..||..|.|:::|..:||..||...|.|
  Fly   336 GPCGTIGWPSVFTRTAKFYKWIRAHLRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 77/264 (29%)
Tryp_SPc 252..482 CDD:214473 75/259 (29%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 76/269 (28%)
Tryp_SPc 104..360 CDD:238113 78/271 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.