DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Prss3b

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:230 Identity:70/230 - (30%)
Similarity:120/230 - (52%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 PWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDW--DLKSDREIFLSEQREVER 320
            |:.|:: :.|.:..|||||....|::.||   ..::.:.||.|:.  |:....|.|:    :..:
  Rat    37 PYQVSL-NAGYHFCGGSLINSQWVVSAAH---CYKSRIQVRLGEHNIDVVEGGEQFI----DAAK 93

  Fly   321 AVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYST 385
            .:.|..::..:..|::.|:.||||..||..:.|:.||....| :|.:|.|:|||........|.:
  Rat    94 IIRHPSYNANTFDNDIMLIKLNSPATLNSRVSTVSLPRSCGS-SGTKCLVSGWGNTLSSGTNYPS 157

  Fly   386 VLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGG-ELGRDTCTGDGGSALFCSIGGENSG 449
            :|:.:...|::.:.|    :|:..|   ::..|:.|.|. |.|:|:|.||.|..:.|:  |:..|
  Rat   158 LLQCLDAPVLSDSSC----KSSYPG---KITSNMFCLGFLEGGKDSCQGDSGGPVVCN--GQLQG 213

  Fly   450 VYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITE 484
            |      |:||.||.|:|.|.:||:|..:.|||.:
  Rat   214 V------VSWGYGCAQKGKPGVYTKVCNYVNWIQQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 70/230 (30%)
Tryp_SPc 252..482 CDD:214473 68/226 (30%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 68/226 (30%)
Tryp_SPc 25..243 CDD:238113 70/230 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.