| Sequence 1: | NP_609840.1 | Gene: | SPH93 / 35049 | FlyBaseID: | FBgn0032638 | Length: | 494 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_037217.3 | Gene: | Plau / 25619 | RGDID: | 3343 | Length: | 432 | Species: | Rattus norvegicus | 
| Alignment Length: | 367 | Identity: | 100/367 - (27%) | 
|---|---|---|---|
| Similarity: | 149/367 - (40%) | Gaps: | 99/367 - (26%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   196 GNPTNNGGNPTTNF-GNPTNNGGNP-----TTNVGSSELLSPSCGMSN---------------AN 239 
  Fly   240 GLQ------MVE--------GITIDQ---------ARP------------AQYPWAVAIFHNGQ- 268 
  Fly   269 -----YLAGGSLIQPNVVLTVAHRVIT--IETELVVRAGDWDLKSDREIFLSEQR--EVERAVIH 324 
  Fly   325 EGFDFKSGA--NNLALLFLNS-------PFKLNDHIRTICLPTPNKSFA--GRRCTVAGWGKMRY 378 
  Fly   379 EDQRYSTVLKKVQLLVVNRNVCEK--FLRSTRLGAKFELPKNIICAGG-ELGRDTCTGDGGSALF 440 
  Fly   441 CSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| SPH93 | NP_609840.1 | GRP | <136..189 | CDD:254089 | |
| Tryp_SPc | 250..485 | CDD:238113 | 81/278 (29%) | ||
| Tryp_SPc | 252..482 | CDD:214473 | 77/265 (29%) | ||
| Plau | NP_037217.3 | Binds urokinase plasminogen activator surface receptor | 34..57 | ||
| KR | 67..152 | CDD:238056 | 18/78 (23%) | ||
| Connecting peptide | 152..178 | 5/25 (20%) | |||
| Tryp_SPc | 178..420 | CDD:214473 | 75/260 (29%) | ||
| Tryp_SPc | 179..423 | CDD:238113 | 77/261 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||