DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and Plau

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:367 Identity:100/367 - (27%)
Similarity:149/367 - (40%) Gaps:99/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GNPTNNGGNPTTNF-GNPTNNGGNP-----TTNVGSSELLSPSCGMSN---------------AN 239
            ||..:..|...|:. |.|.....:|     |.|...|:.||...|..|               ..
  Rat    73 GNGQSYRGKANTDTKGRPCLAWNSPAVLQQTYNAHRSDALSLGLGKHNYCRNPDNQRRPWCYVQI 137

  Fly   240 GLQ------MVE--------GITIDQ---------ARP------------AQYPWAVAIFHNGQ- 268
            ||:      ||:        ..|:||         .||            ...||..||:...: 
  Rat   138 GLKQFVQECMVQDCSLSKKPSSTVDQQGFQCGQKALRPRFKIVGGEFTVVENQPWFAAIYLKNKG 202

  Fly   269 -----YLAGGSLIQPNVVLTVAHRVIT--IETELVVRAGDWDLKSDREIFLSEQR--EVERAVIH 324
                 :..|||||.|..|.:..|..:.  .:.|.||..|    :|.|..:...:.  |||:.::|
  Rat   203 GSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYLG----QSKRNSYNPGEMKFEVEQLILH 263

  Fly   325 EGFDFKSGA--NNLALLFLNS-------PFKLNDHIRTICLPTPNKSFA--GRRCTVAGWGKMRY 378
            |.|..::.|  |::|||.:.:       |.:.   |:||||| |....|  |..|.:.|:|:...
  Rat   264 EDFSDETLAFHNDIALLKIRTSTGQCAQPSRT---IQTICLP-PRFGDAPFGSDCEITGFGQESA 324

  Fly   379 EDQRYSTVLKKVQLLVVNRNVCEK--FLRSTRLGAKFELPKNIICAGG-ELGRDTCTGDGGSALF 440
            .|..|...||...:.:::...|::  :..|       |:...::||.. |...|:|:||.|..|.
  Rat   325 TDYFYPKDLKMSVVKIISHEQCKQPHYYGS-------EINYKMLCAADPEWKTDSCSGDSGGPLI 382

  Fly   441 CSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482
            |:|.|..:    .:|||:||.||.::..|.:||.||.|.|||
  Rat   383 CNIDGRPT----LSGIVSWGSGCAEKNKPGVYTRVSYFLNWI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 81/278 (29%)
Tryp_SPc 252..482 CDD:214473 77/265 (29%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056 18/78 (23%)
Connecting peptide 152..178 5/25 (20%)
Tryp_SPc 178..420 CDD:214473 75/260 (29%)
Tryp_SPc 179..423 CDD:238113 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.