DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and TPSD1

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:242 Identity:74/242 - (30%)
Similarity:115/242 - (47%) Gaps:38/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VGSSELLSPSCGMSNANGLQMVEGITIDQARP-AQYPWAVAIFHNGQY---LAGGSLIQPNVVLT 283
            :.|...::|:.|.:    ||.. ||...|..| :::||.|::...|.|   ..|||||.|..|||
Human    19 LASPAYVAPAPGQA----LQQT-GIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLT 78

  Fly   284 VAHRVITIETELVVRAGDWDLKSDREIFLSEQR--------EVERAVIHEGFDFKSGANNLALLF 340
            .||   .:|.::.      ||.:.| :.|.||.        .|.|.::|..|.......::|||.
Human    79 AAH---CVEPDIK------DLAALR-VQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLE 133

  Fly   341 LNSPFKLNDHIRTICLPTPNKSF-AGRRCTVAGWGKMRYEDQRYST----VLKKVQLLVVNRNVC 400
            |..|..::.||.|:.||..:::| .|..|.|.|||.:   |.....    .||:|::.||..::|
Human   134 LEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDV---DNNVHLPPPYPLKEVEVPVVENHLC 195

  Fly   401 E-KFLRSTRLGAKFELPK-NIICAGGELGRDTCTGDGGSALFCSIGG 445
            . ::......|..|::.: :::|||.| ..|:|.||.|..|.|.:.|
Human   196 NAEYHTGLHTGHSFQIVRDDMLCAGSE-NHDSCQGDSGGPLVCKVNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 67/215 (31%)
Tryp_SPc 252..482 CDD:214473 66/213 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 68/218 (31%)
Tryp_SPc 38..240 CDD:214473 67/215 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.