DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and F11

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:317 Identity:92/317 - (29%)
Similarity:139/317 - (43%) Gaps:50/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 YPTTNVGNPTNNGGNPTTNFGNPTNNGGNPTTNV----GSSELLSPSCGMSN----------ANG 240
            ||:..:.|..|..|......    ::.|:||..:    |.|......|.|.|          ..|
Mouse   333 YPSHRLCNERNRRGRCYLKL----SSNGSPTRILHGRGGISGYSLRLCKMDNVCTTKINPRVVGG 393

  Fly   241 LQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVR-----AG 300
            ...|.|         ::||.|.:..:..:|.|||:|....:||.||....|||...:|     ..
Mouse   394 AASVHG---------EWPWQVTLHISQGHLCGGSIIGNQWILTAAHCFSGIETPKKLRVYGGIVN 449

  Fly   301 DWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTP-NKSFA 364
            ..::......|     .|:..:||:.:.......::|||.|.|.....|..|.||||:. :::..
Mouse   450 QSEINEGTAFF-----RVQEMIIHDQYTTAESGYDIALLKLESAMNYTDFQRPICLPSKGDRNAV 509

  Fly   365 GRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAG-GELGR 428
            ...|.|.|||......:..|| |:|.::.:|:...|:...|      :.::...:|||| .|.|:
Mouse   510 HTECWVTGWGYTALRGEVQST-LQKAKVPLVSNEECQTRYR------RHKITNKMICAGYKEGGK 567

  Fly   429 DTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEK 485
            |||.||.|..|.|    :.:||:...||.:||.||||:..|.:||.|:|:.:||.||
Mouse   568 DTCKGDSGGPLSC----KYNGVWHLVGITSWGEGCGQKERPGVYTNVAKYVDWILEK 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/241 (31%)
Tryp_SPc 252..482 CDD:214473 72/236 (31%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519 10/46 (22%)
Tryp_SPc 389..617 CDD:214473 75/252 (30%)
Tryp_SPc 390..617 CDD:238113 75/251 (30%)
Heparin-binding. /evidence=ECO:0000250 547..550 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.