DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and PFI

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_565017.1 Gene:PFI AraportID:AT1G71440 Length:531 Species:Arabidopsis thaliana

Alignment Length:630 Identity:133/631 (21%)
Similarity:229/631 (36%) Gaps:191/631 (30%)


  Fly   118 ANTEQFIIGQRVWL--GGTRPGQIAFIGDTHFAAGEWAGVVLDEP-NGKNDGCVSGKRYFQCEPK 179
            ::.|.|||||||..  ...|.|.:.::||....:|.|.||..|:. :||::|.|:|..||.    
plant     5 SSNESFIIGQRVHSLNDSRRVGTVKYVGDVEGYSGTWIGVDWDQDGDGKHNGSVNGVFYFN---- 65

  Fly   180 RGIFSRLTRLTTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSPGIGGKNGMAVGDRVI 244
                           ..:|:..|.:...:..|..|:     :::..||...|..|:   ..|.:.
plant    66 ---------------GRSQSSASFVRSQNLSRGITL-----LQALELRYRTISTKD---EEDEMY 107

  Fly   245 VSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFVPIAKVSLS 309
            |.|. |:|...::.||..:..         |:.|...:.|...:.|.... ..||...:.  |:.
plant   108 VLSA-GNRRVSIQLLGGDKIQ---------DKLSRFEELTSASLSYLGVS-SLGVSSDLG--SIL 159

  Fly   310 PSSKKTRLSRTGSR-----------ESLTSIGTMNSIATTATSRMRMNAQQRKSSTPVKPILATP 363
            |:.|  .|..||:.           |.|.::.|:|....:.:|.::...|.:.....|   |...
plant   160 PNLK--LLDLTGNLISDWEEIGALCEQLPALTTLNLSCNSLSSDIKSLPQLKNIRVLV---LNNS 219

  Fly   364 KSQFSMQDLLREKQQHVEKL-----MVERDLDREDAQNQALQLQKNINELKARIVELESALDN-- 421
            ...::..::||.....:|:|     |:........:.:||      .|.|  |::.|:   ||  
plant   220 GLSWTQVEILRRSLPGIEELHLMGNMISTITSTSSSDDQA------FNSL--RLLNLD---DNCI 273

  Fly   422 ----ERKKTEELQCSIDEAQFCGDELNAQSQVY--KEKIHDLESKITKLVSAT----------PS 470
                |..|..:|.|              ..|:|  |.|:    |:|.:.|:.|          ||
plant   274 SDWSEVLKLSQLPC--------------LEQLYLNKNKL----SRIFQSVNGTESSEKGSDPFPS 320

  Fly   471 LQSIL-----PPDLPSDDG----------ALQEE---------------IAKLQEKMTIQQKEVE 505
            |..:|     ..||.|.|.          .|.|.               :|:|.:...:...||.
plant   321 LSCLLLGANNIGDLASVDALNGFPQLVDIRLSENPISDPVRGGVPRFVLVARLTKVQVLNGSEVR 385

  Fly   506 SRIAEQLEEEQRLRENVKYLNEQIATLQSELVSKDEALEKFSLSECGIENLRRELELLKEENEKQ 570
            :|  |:.:.|      ::|:...::.|      .|::.|        ||.|......||:.:..:
plant   386 AR--EKKDSE------IRYVRMVMSKL------NDKSGE--------IELLHPRFYELKKLHGIE 428

  Fly   571 AQEAQAEFT--RKLAEKSVEVLRLSSELQNLKATSDSL-ESERVNKTDECEILQTEVRMRDEQIR 632
            .:.|.||.:  :.:|...:.:        .||....|: |...:.|.....|...::::..|...
plant   429 DERASAENSGPKNIASGLISI--------TLKCVGPSMGEKPHLTKKLPGSITVGKLKILSENFF 485

  Fly   633 ELNQQLDEVTTQLNVQKADS---SALDDMLRLQKEGTEEKSTLLE 674
            :|.    .:..:|.:|:..|   :||||          |.:|||:
plant   486 KLK----SIKPRLFLQEEGSPFPTALDD----------ETATLLD 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625 20/66 (30%)
NIP100 237..815 CDD:227569 101/509 (20%)
CAP_GLY 240..306 CDD:279625 13/66 (20%)
Mplasa_alph_rch 592..1328 CDD:275316 19/88 (22%)
TMPIT 772..>882 CDD:285135
TMPIT 1175..>1271 CDD:285135
BAR 1281..1466 CDD:299863
SHE3 1327..1541 CDD:293683
CLIP1_ZNF 1621..1638 CDD:293247
CLIP1_ZNF 1668..1684 CDD:293247
PFINP_565017.1 CAP_GLY 12..81 CDD:214997 23/88 (26%)
LRR_RI 134..358 CDD:238064 53/261 (20%)
leucine-rich repeat 136..161 CDD:275380 6/28 (21%)
leucine-rich repeat 162..187 CDD:275380 6/27 (22%)
leucine-rich repeat 188..210 CDD:275380 4/22 (18%)
leucine-rich repeat 211..225 CDD:275380 2/17 (12%)
leucine-rich repeat 236..262 CDD:275380 6/32 (19%)
leucine-rich repeat 263..287 CDD:275380 8/29 (28%)
leucine-rich repeat 288..320 CDD:275380 9/36 (25%)
leucine-rich repeat 321..345 CDD:275380 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
10.910

Return to query results.
Submit another query.