DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and Drp2

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_076461.1 Gene:Drp2 RGDID:621750 Length:957 Species:Rattus norvegicus

Alignment Length:989 Identity:177/990 (18%)
Similarity:334/990 (34%) Gaps:313/990 (32%)


  Fly   723 NQIQLEKESIEQQLALKQNELEDFQKKQSESEVHLQEIKAQNTQKDFELVESGESLKKLQQQLEQ 787
            |:|:.:..::..:       ||.|.....:.::.||||....:|||          ::|..||  
  Rat    84 NEIKKKSHNLRAR-------LEAFSDHSGKLQLPLQEIIDWLSQKD----------EELSAQL-- 129

  Fly   788 KTLGHEKLQAALEELKKEKETIIKEKEQELQQLQSKSAESESALKVVQVQLEQLQQQAAASGEEG 852
                  .||..:..:::||||    ....:::::||.....|.|:..|..|.|...:        
  Rat   130 ------PLQGDVALVQQEKET----HAAFMEEVKSKGPYIYSVLESAQAFLSQHPFE-------- 176

  Fly   853 SKTVAKLHDEISQLKSQAEETQSELKSTQSNLEAKS------KQLEAANGSLE-------EEAKK 904
                            :.||:.||.|.|......::      ||...|:...|       ::.:.
  Rat   177 ----------------ELEESHSESKDTSPRQRIQNLSRFVWKQATVASELWEKLTARCVDQHRH 225

  Fly   905 SGHLLEQITKLKSEVGETQAALSSCHTDVESKTKQLEAANAALEKVNKEYAES-----------R 958
            ..|.||.:.:::..:.|..:.|:           |.|...|..|.:...:.:|           :
  Rat   226 IEHTLEHLLEIQGAMEELSSTLT-----------QAEGVRATWEPIGDLFIDSLPEHIQAIKLFK 279

  Fly   959 AEASDLQDKVKEITDTLHAELQAERSSSSALHTKL--SKFSDEIATGHKELTSKADAWSQEMLQK 1021
            .|.|.::|.||.:.|..|      :.:.|.:|..:  |:..::|....|:|              
  Rat   280 EEFSPVKDGVKLVNDLAH------QLAISDVHLSMENSRALEQINVRWKQL-------------- 324

  Fly  1022 EKELQELRQQLQDSQDSQTKLKAEGERKEKSFEESIKNLQEEVTKAKTENLELSTGTQTTIKDLQ 1086
            :..:.|..:||||:.      :..|...:.....|::...|...........::...|||..|..
  Rat   325 QVSVAERLKQLQDAH------RDFGPGSQHFLSTSVQVPWERAISPNKVPYYINHQAQTTCWDHP 383

  Fly  1087 ERLEI--TNAELQHKEKMASEDAQKI--------ADLKTLVEAIQVANANISATNAELSTVLEVL 1141
            :..|:  |.|:|.:.:..|...|.|:        .||.||..|:::.|.:....:..:..|:||:
  Rat   384 KMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDLVTLTTALEIFNEHDLQASEHVMDVVEVI 448

  Fly  1142 QAEKSETNHIFELFEME----------ADMN--------------SERLIEKVTGIK----EELK 1178
            ..    ...::|..|.|          .||:              ..|.:...|||.    .|:|
  Rat   449 HC----LTALYERLEEERGILVNVPLCVDMSLNWLLNVFDSGRSGKMRALSFKTGIACLCGTEVK 509

  Fly  1179 ETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDSVKQKEELV--- 1240
                         |:|:....|...|..|..|.         .:...|.|.....:|..|:.   
  Rat   510 -------------EKLQYLFSQVANSGSKCDQR---------HLGALLHEAIQVPRQLGEVAAFG 552

  Fly  1241 -QNLEEKVR------------ESSSIIEAQNTK---------LNESNV--QLENKTSC------- 1274
             .|:|..||            |:|..:|..|.:         |:...|  |::::|.|       
  Rat   553 GSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTVAEQVKHQTKCSICRQCP 617

  Fly  1275 --------LKETQDQLLES-----------------------QKKEKQLQEEAAKLSGELQQVQE 1308
                    ||:....:.::                       ....:.:::.|..|..:.:..|.
  Rat   618 IKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPTTSSENMRDFATTLKNKFRSKQY 682

  Fly  1309 ANGDIKDSLVKVEELVKVLEEKLQ--AATSQLDAQQATNKELQELLVKSQENEGN---------- 1361
            .:...:...:.|:   .|||....  .|:|.:.....|:..::....:..|.|..          
  Rat   683 FSKHPQRGYLPVQ---SVLESDCSETPASSPMLPHADTHSRIEHFASRLAEMESQNCSFFNDSLS 744

  Fly  1362 ----------LQGESLAVTEK---------LQQLEQANGELKEALCQKENGLKELQGKLD----- 1402
                      |...|..:|::         .....::.|||::.|...|:..:.|||:|.     
  Rat   745 PDDSIDEDQYLLRHSSPITDREPAFGQQAPCSMATESKGELEKILAHLEDENRILQGELRRLKWQ 809

  Fly  1403 -----ESNTVLESQKKSHNEIQDKLEQAQQKERTLQEETSKLAEQLSQLKQANEELQKSLQQ-KQ 1461
                 |:.|:.|...::..:.::  |:...:.|.|::..|:|..::..|:..|::|:..||: ::
  Rat   810 HEEAVEAPTLAEGSAEATPDHRN--EELLAEARILRQHKSRLETRMQILEDHNKQLESQLQRLRE 872

  Fly  1462 LLLEKGNEFD------TQLAEYQKV---------------IDEMDDAASVKSALLEQLQNRVAEL 1505
            |||:...|.|      :.||...:.               .:..||..|....:...|::.:.:|
  Rat   873 LLLQPPTESDGNGSAGSSLASSPRQSEGSHPREKGQTTPDTEAADDVGSKSQDVSHSLEDIMEKL 937

  Fly  1506 ETALRQANDAQKTA 1519
            ..|......:..||
  Rat   938 RHAFPSVRSSDVTA 951

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625
NIP100 237..815 CDD:227569 21/92 (23%)
CAP_GLY 240..306 CDD:279625
Mplasa_alph_rch 592..1328 CDD:275316 131/734 (18%)
TMPIT 772..>882 CDD:285135 22/110 (20%)
TMPIT 1175..>1271 CDD:285135 23/123 (19%)
BAR 1281..1466 CDD:299863 40/250 (16%)
SHE3 1327..1541 CDD:293683 47/257 (18%)
CLIP1_ZNF 1621..1638 CDD:293247
CLIP1_ZNF 1668..1684 CDD:293247
Drp2NP_076461.1 Spectrin 1 102..179 23/123 (19%)
SPEC 111..339 CDD:238103 61/305 (20%)
Spectrin 2 231..337 25/137 (18%)
WW 357..385 CDD:238122 5/28 (18%)
EF-hand_2 386..504 CDD:286194 25/122 (20%)
EF-hand_3 508..599 CDD:286195 20/113 (18%)
ZZ_dystrophin 608..656 CDD:239074 4/48 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.