DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and NBPF9

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_001264373.1 Gene:NBPF9 HGNCID:31991 Length:1111 Species:Homo sapiens

Alignment Length:1140 Identity:237/1141 (21%)
Similarity:397/1141 (35%) Gaps:330/1141 (29%)


  Fly   695 EQLEKQISDLKQLAEQEKLVREMTENAINQIQLEKESIEQQLA---------LKQNELEDFQKKQ 750
            |:.|..|.::     .|||..::.||......|::.....|||         .|..|.:|..|..
Human    11 EKAEMNILEI-----NEKLRPQLAENKQQFGNLKERCFLTQLAGFLANRQKKYKYEECKDLIKFM 70

  Fly   751 SESEVHLQEIKAQNTQKDFELVESGESLKKLQQQLEQKTLGHEKLQAALEELKKEKETIIKEKEQ 815
            ..:|...:|                   :||.:||:|           .|||::.| .::..:|:
Human    71 LRNERQFKE-------------------EKLAEQLKQ-----------AEELRQYK-VLVHSQER 104

  Fly   816 ELQQLQSKSAESESALKVVQVQL--------------EQLQQQAAASGEEGSKTVAKL---HDEI 863
            ||.||:.|..|...|.:.:...|              :.||:|.|.........|.||   :||.
Human   105 ELTQLKEKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDED 169

  Fly   864 SQLKSQAEETQSELKSTQSNLEAKSKQLEAANGSLEEEA-----------KKSGHLLEQITKLKS 917
            .....|.||.:..|:|:......|:::.:.|..||||.|           ....|...:||..:.
Human   170 EDEDVQVEEDEKVLESSAPREVQKAEESKVAEDSLEECAITCSNSHGPCDSNQPHKNIKITFEED 234

  Fly   918 EVGETQAA-LSSCHTDVESKTKQL-------EAANAAL--------------------EKVNKEY 954
            ||..|... ..|.|.:.:.....|       .|.|.::                    ||:..:.
Human   235 EVNSTLVVDRESSHDECQDALNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNILEINEKLRPQL 299

  Fly   955 AESRAEASDLQD------------------KVKEITDTLHAELQAERSSSSALHTKLSKFSDE-I 1000
            ||.:.:..:|::                  |.:|..|.:...|:.||           :|.:| :
Human   300 AEKKQQFRNLKEKCFLTQLAGFLANQQNKYKYEECKDLIKFMLRNER-----------QFKEEKL 353

  Fly  1001 ATGHKELTSKADAWSQEMLQ-------KEKELQELRQQLQDSQDSQTKL--------------KA 1044
            |...|:        ::|:.|       :|:||.:||::|::.:|:...|              |:
Human   354 AEQLKQ--------AEELRQYKVLVHAQERELTQLREKLREGRDASRSLNEHLQALLTPDEPDKS 410

  Fly  1045 EGERKEKSFEESIKNLQEEVTKAKTENLELSTGTQTTIKDLQERLEITNAELQHKEKMASEDAQK 1109
            :|:..::...|..:..|..|.|...||          ..|..|.::|..||...|.. |..:.||
Human   411 QGQDLQEQLAEGCRLAQHLVQKLSPEN----------DNDDDEDVQIEVAEKVQKSS-APREMQK 464

  Fly  1110 IADLKTLVEAIQVANANISATNAELSTVLEVLQAEKSETNHIFELFEMEADMNSERLIEKVTGIK 1174
            ..:.:...::::......|.::....          |...|.......|.|.....||...:.::
Human   465 AEEKEVPEDSLEECAITYSNSHGPYD----------SNQPHRKTKITFEEDKVDSTLIGSSSHVE 519

  Fly  1175 EELKETHLQLDERQKKFEELEEK----LKQAQQS-EQKLQQESQTSKEKLTEIQQSLQELQDSVK 1234
            .| ...|: :.|.:...||.|||    .:..|:| |:::.|||.........|.   .|:..|.|
Human   520 RE-DAVHI-IPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTPSIP---PEMLASYK 579

  Fly  1235 QKEELVQNLEEKVRESSSIIEAQNTKLNESNVQLENKTSCLKETQDQLLESQKKEKQLQEEAAKL 1299
            .......:|||:                    |:.......:...||:    |||.| :....:|
Human   580 SYSSTFHSLEEQ--------------------QVCMAVDIGRHRWDQV----KKEDQ-EATGPRL 619

  Fly  1300 SGELQQVQEANGDIKDSLVKVEELVKVLEEKLQAATSQ----LDAQQATNKELQELLVKSQENEG 1360
            |.||..               |:..:||::.|....|.    |:...:.........|..|:..|
Human   620 SRELLD---------------EKGPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAFYVLEQQRVG 669

  Fly  1361 NLQGESLAV----TEKLQQLEQANGELKEALCQKENGLKELQGKLDESN-TVLE-------SQKK 1413
                  |||    .||.|::|    |.::..|.:.:  :||   |||.. .||:       |...
Human   670 ------LAVDMDEIEKYQEVE----EDQDPSCPRLS--REL---LDEKEPEVLQDSLGRWYSTPS 719

  Fly  1414 SHNEIQDKLEQAQQKERTLQEETSKLAEQLSQLKQANEELQKS-----LQQKQLLLEKGNEFDTQ 1473
            .:.|:.|..:.......:|:|:...||..|.::|:..||.:..     ...::||         :
Human   720 GYLELPDLGQPYSSAVYSLEEQYLGLALDLDRIKKDQEEEEDQGPPCPRLSRELL---------E 775

  Fly  1474 LAEYQKVIDEMDDAASVKSALLEQLQNRVAELETALRQANDAQKTAY-LETKELRRQLESLELEK 1537
            :.|.:.:.|.:|...|..|:.|||..:           ......:.| ||.|.:...|:..|:||
Human   776 VVEPEVLQDSLDRCYSTPSSCLEQPDS-----------CQPYGSSFYALEEKHVGFSLDVGEIEK 829

  Fly  1538 SREVLSLKAQMNGASSRSGKG------------------DEVESLDIETSLAKINFLNSIIADMQ 1584
            ..:....:.:.:....|.|:.                  ||.|...::.||.:.....|...::.
Human   830 KGKGKKRRGRRSKKKRRRGRKEGEENQNPPCPRLSRELLDEKEPEVLQDSLDRCYSTPSGYLELP 894

  Fly  1585 QKNDALKAKVQTLE------TLPMDFTKPHAFDALTKRKPAPRLFCDICDEFDQHDTEDCPIQGS 1643
            .......:.|.:||      .|.:|..|....:...:..|.|||..::.:.     .|...:|.|
Human   895 DLGQPYSSAVYSLEEQYLGLALDVDRIKKDQEEEEDQGPPCPRLSRELLEV-----VEPEVLQDS 954

  Fly  1644 EDQDYSTPSSESNNNEKERKLPAPRKYCDSCEVFG 1678
            .|:.||||||         .|..|    |||:.:|
Human   955 LDRCYSTPSS---------CLEQP----DSCQPYG 976

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625
NIP100 237..815 CDD:227569 28/129 (22%)
CAP_GLY 240..306 CDD:279625
Mplasa_alph_rch 592..1328 CDD:275316 152/743 (20%)
TMPIT 772..>882 CDD:285135 32/127 (25%)
TMPIT 1175..>1271 CDD:285135 22/101 (22%)
BAR 1281..1466 CDD:299863 47/206 (23%)
SHE3 1327..1541 CDD:293683 52/236 (22%)
CLIP1_ZNF 1621..1638 CDD:293247 3/17 (18%)
CLIP1_ZNF 1668..1684 CDD:293247 4/12 (33%)
NBPF9NP_001264373.1 SMC_N <10..>401 CDD:330553 93/445 (21%)
DUF1220 <189..240 CDD:310992 13/51 (25%)
DUF1220 451..511 CDD:310992 10/71 (14%)
DUF1220 540..597 CDD:310992 15/80 (19%)
DUF1220 608..672 CDD:310992 19/86 (22%)
DUF1220 682..747 CDD:310992 17/74 (23%)
DUF1220 757..822 CDD:310992 16/85 (19%)
DUF1220 856..916 CDD:310992 9/60 (15%)
DUF1220 926..991 CDD:310992 20/70 (29%)
DUF1220 1024..1085 CDD:310992
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.