DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and DCTN1-p150

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_524061.1 Gene:DCTN1-p150 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster

Alignment Length:1483 Identity:313/1484 (21%)
Similarity:582/1484 (39%) Gaps:395/1484 (27%)


  Fly   125 IGQRVWL-GGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSGKRYFQCEPKRGIFSRLTR 188
            :|.||.| |....|.:|::|.|.||.|:|.|||||||.|||.|.:.|::||||:...|:|.|.|:
  Fly     8 VGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCGMFVRPTQ 72

  Fly   189 L-----------TTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSPGIGGKNGM--AVG 240
            |           :...::|| |||:    :.|.::|..|...|:.||  |...:|.:..:  ::.
  Fly    73 LRLLEAAPGSRRSIEDVSGA-TPTA----AQPTKARLSSSRTSLSSS--RQSLLGSRTQLTTSLS 130

  Fly   241 DRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFVPIAK 305
            :|...||..|.|..:         ||.|                                   :|
  Fly   131 ERTASSSSIGPRKSL---------APQN-----------------------------------SK 151

  Fly   306 VSLSPSSKKTRLSRTGSRESLTSIGTMNSIATTATSRMRMNAQQRKSSTPVKPILATPKSQFSMQ 370
            ...|||        |...|...:....|..|:.|:|        :::|......|...|.||:..
  Fly   152 DKESPS--------TSLAEGAPAASGGNGAASHASS--------KRASFVETGFLEILKPQFTPS 200

  Fly   371 DLLREKQQHVEKLMVERDLDREDAQNQALQLQKNINELKARIVELESALDNERKKTEELQCSIDE 435
            ..||.     ....:..:...|| :...|:.||...||:|::.:|...|:..:::..|.:..:.|
  Fly   201 QPLRS-----PSFTMPSNSGAED-KVALLEAQKTSAELQAQLADLTEKLETLKQRRNEDKERLRE 259

  Fly   436 AQFCGDELNAQSQVYKEKIHDLESKITKLVSATPSLQSILPPDLPSDDGALQEEI--AKLQEKMT 498
            .    |::..|       ...|:...||::.|..|               ||:|:  ||.:.|..
  Fly   260 F----DKMKIQ-------FEQLQEFRTKIMGAQAS---------------LQKELLRAKQEAKDA 298

  Fly   499 IQQKEVESRIAEQLEEEQRLRENVKYL-------NEQIATLQSELVSKDEALEKFSLSECGIENL 556
            |:.||      :..:|...|.:||:.:       .|:..|||.||.|..|.          ||.|
  Fly   299 IEAKE------QHAQEMADLADNVEMITLDKEMAEEKADTLQLELESSKER----------IEEL 347

  Fly   557 RRELELLKEENEKQAQEAQAEFTRKLAEKSVEVLRLSSELQNLKATSDSLESERVNKTDECEILQ 621
            ..:||||:.|.:.:|:.|                     :.|:....||                
  Fly   348 EVDLELLRSEMQNKAESA---------------------IGNISGGGDS---------------- 375

  Fly   622 TEVRMRDEQIRELNQQLDEVTTQLNVQKADSSALDDMLRLQKEGTEEKSTLLEKTEKELVQSKEQ 686
              ..:...:.::|.||        |::..::     ::||:.....:|.. ::|..|||...:.:
  Fly   376 --PGLSTYEFKQLEQQ--------NIRLKET-----LVRLRDLSAHDKHD-IQKLSKELEMKRSE 424

  Fly   687 AAKTLNDKEQLEKQISDLKQLAEQEKLVREMTENAINQIQLEKESIEQQLALKQNELEDFQKKQS 751
            ..:....||:|..:|.:|      |.:|.::.|..  ...|..|.:.:|||.|:.||||..|...
  Fly   425 VTELERTKEKLSAKIDEL------EAIVADLQEQV--DAALGAEEMVEQLAEKKMELEDKVKLLE 481

  Fly   752 ESEVHLQEIKAQNTQKDFELVESGESLK-KLQQQLE-----QKTLGHEKLQAALEELKKEKETII 810
            |....|:.::..:.|    ||||...|: .|:::|:     :|.:..|: .||:|.:....:||:
  Fly   482 EEIAQLEALEEVHEQ----LVESNHELELDLREELDLANGAKKEVLRER-DAAIETIYDRDQTIV 541

  Fly   811 KEKE------------------QELQQLQSKS--------------AESESALKVVQVQLEQLQ- 842
            |.:|                  .|.:.||..|              |||::..:.:.|||.|:: 
  Fly   542 KFRELVQKLNDQLTELRDRNSSNEKESLQDPSLKMVTETIDYKQMFAESKAYTRAIDVQLRQIEL 606

  Fly   843 -------QQAAASGEEGSKTVAKLHDE------ISQLKSQAEETQSELKSTQSNLEAKSKQLEAA 894
                   |...|...|...:....||.      ||::..:.:...|:.:.....::|.:::....
  Fly   607 SQANEHVQMLTAFMPESFMSRGGDHDSILVILLISRIVFKCDIVVSQTRERFPPVDAITREAVTQ 671

  Fly   895 NGSLEEEAKKSGHLLEQITKLKSEVGETQAALSSCHTD----VESKTKQLEAANAALEKVNKEYA 955
            ..::::.|.|. .||..:..|:..:.:....|:||..|    ..|...::.|....::.:.:...
  Fly   672 GHAVQQYAFKC-RLLHYVHSLQCALHQILYGLNSCQPDTLLRAGSSLPEMVAQEKIVDGIIELLK 735

  Fly   956 ESRAEASDLQDKVKEITDTLHA-------------ELQAERSSSSALHTKLSKFSDEIATGHKEL 1007
            .::.:.:...|.:::.....:|             |:|..|...::|.........:.|.. |.:
  Fly   736 SNQLDENSTTDNIEKCVAFFNAMNSVLLAGEQLLNEIQMIRDCVASLGAACESILSDTAIA-KVI 799

  Fly  1008 TSKADAWSQEMLQKE---KELQELRQQ---LQDSQDSQTKLKAEGERKEKSFEESIKNLQEEVTK 1066
            ..:|.|.|..:|..:   :.::.:|||   ::....|...:...|..:.|  .|:::.|.:.:::
  Fly   800 IQEAGATSDSVLLIQFLNENMESVRQQVKLIKRRLPSDQHVIKSGLSQHK--VEAMRGLAQNISR 862

  Fly  1067 AKTENLELSTGTQTTIKDLQERLEITNAELQH---KEK------------MASEDAQKIADLKTL 1116
            ..:   .:...|:.::..:...:|..|| .:|   :||            ...:|.....:.|||
  Fly   863 IMS---AMHQATKQSLAAIVSTIESDNA-AEHTLPQEKYWALLTASCERIYEQDDRGPTQNFKTL 923

  Fly  1117 VEAIQVANANISATNAELSTV--------LEVLQAEKSETNHIFELFEMEADMNSERLIEKVTGI 1173
                      ::..|::|..:        .:::.|..:.:|      :.::..:|..:.::...|
  Fly   924 ----------LAQANSDLQLIAQHLLDKEYDIISAANNASN------QQKSGAHSTPITQRAQLI 972

  Fly  1174 KEELKETHL---QLDERQKKFEELE--EKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDSV 1233
            |::|::.::   .|:.|:...::|:  .|:||.:.||.:::::  .:::||:.:|...:...|..
  Fly   973 KKQLEQKNVLAATLENREADVKQLKVAAKMKQNELSEMQIRKD--LAEKKLSVLQNEYEHAVDKW 1035

  Fly  1234 KQKEELVQNLEEKVRESSSIIEAQNTKLNESNVQLENKTSCLKETQDQL------LESQKKEKQL 1292
            |||.|                        |:::||:.|....:||.|.|      |||:|.:.:.
  Fly  1036 KQKYE------------------------ETSLQLQLKEKEFEETMDHLQSDIDALESEKSDLRD 1076

  Fly  1293 QEEAAKLSGELQQVQEANGDIKDSL---VKVEELVKVLEEKLQAATSQLDAQQ------ATNKEL 1348
            :.:....:|::|...|::.....||   ......:..:.....|.|:.:.|::      |.|:|.
  Fly  1077 KLKLNSTTGKVQPGSESHSPHNISLSGNTSTAPGISNVSYSAPAGTAPVVAEEVELLKNAFNQER 1141

  Fly  1349 -QELLVKSQENEGNL-QGESLAV----TEKLQQLEQANGELKEALCQKENGLKELQGKLDESNTV 1407
             |.|.:::|:....| |.|.|.|    .:::..||.....:|.|..     |..||.:..:|   
  Fly  1142 NQRLRLQAQDMRAKLSQFEPLHVPQPQDQRITALESELTRMKHAWV-----LSLLQVRSQDS--- 1198

  Fly  1408 LESQKKSHNEIQDKLEQAQQKERTLQEETSKLAEQLSQLKQANEELQKSLQQK 1460
                ..|...|.....|.:.:...|:.|.|..|.||     |::.|.:.||:|
  Fly  1199 ----VNSGTRIDAVALQRRNQPVPLKGEISSKASQL-----ASDILTEYLQRK 1242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625 33/64 (52%)
NIP100 237..815 CDD:227569 127/613 (21%)
CAP_GLY 240..306 CDD:279625 9/66 (14%)
Mplasa_alph_rch 592..1328 CDD:275316 155/848 (18%)
TMPIT 772..>882 CDD:285135 34/162 (21%)
TMPIT 1175..>1271 CDD:285135 20/101 (20%)
BAR 1281..1466 CDD:299863 46/202 (23%)
SHE3 1327..1541 CDD:293683 36/147 (24%)
CLIP1_ZNF 1621..1638 CDD:293247
CLIP1_ZNF 1668..1684 CDD:293247
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 34/66 (52%)
Dynactin 553..834 CDD:289240 46/283 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113096376
eggNOG 1 0.900 E1_COG5244
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18916
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1398
43.960

Return to query results.
Submit another query.