DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and Clip2

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_068837.2 Gene:Clip2 RGDID:62019 Length:1047 Species:Rattus norvegicus

Alignment Length:1249 Identity:320/1250 (26%)
Similarity:556/1250 (44%) Gaps:320/1250 (26%)


  Fly    10 GTSAPFPSPVTADPEPGATASKLPGPIRSNIPTPATSGTGIPQPSKMKAPSSFGSTGSVSKIGRP 74
            |......||| ..|..|:.:|       |.:.:.:.|..|.|...:...|||.|:|.:||:    
  Rat    11 GRGGKHSSPV-GRPSIGSASS-------SVVASASGSKEGSPLHKQASGPSSAGATTTVSE---- 63

  Fly    75 CCNHTTPKSGPPPREATSMSRESDDNLSSINSAYTDNSSAVLTANTEQFIIGQRVWLGGTRPGQI 139
                   |.||...|.      .||.|.                   .|::|:|||:.|.:||.:
  Rat    64 -------KPGPKAAEV------GDDFLG-------------------DFVVGERVWVNGVKPGVV 96

  Fly   140 AFIGDTHFAAGEWAGVVLDEPNGKNDGCVSGKRYFQCEPKRGIFSRLTRLTTYPLA-----GAQT 199
            .::|:|.||.|:|||||||:|.|||||.|.|.|||:|...:|||:|.::||..|.|     .|.:
  Rat    97 QYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPAAEGSGSDAHS 161

  Fly   200 PTSPLAKSSPDRSRTVSPTAS-----IRSSMLRSP-GIGGKNG---------------MAVGDRV 243
            ..|..|::....|.|.:|..:     :|.|:|.|. ..|.::|               :.:||||
  Rat   162 VESLTAQNLSLHSGTATPPLTGRVIPLRESVLNSSVKTGNESGSNLSDSGSVKRGDKDLHLGDRV 226

  Fly   244 IVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFVPIAKV-- 306
            :|.   |::.|::||:|||.||.|.|||||||||.|||||.|...|||:|.||:|:|.||.||  
  Rat   227 LVG---GTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIR 288

  Fly   307 ----SLSPS-SKKTR-----LSRTGSRESLTSIGTMNSIATTATSR-MRMNAQQRKSSTPVKPIL 360
                |.||: :|||:     :|......|.:||.:::|:|::...| .|.......||...:.|.
  Rat   289 IGFPSTSPAKAKKTKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARKIS 353

  Fly   361 ATPKSQFSMQDLLREKQQHVEKLMVERDLDRED---AQNQALQLQKNINELKAR----------- 411
            .|.    ::|:.|:|||||:|:|:.||||:|.:   |.:...:::|.|..|||:           
  Rat   354 GTT----ALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEK 414

  Fly   412 --------------IVELESALDNERKKTEELQCSIDEAQFCGDELNAQSQVYKEKIHDLE-SKI 461
                          .|:|.:.|:.||:|.|:||..::|......:|..|:|:...:|.:|| |.:
  Rat   415 LQRARLLVENVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLL 479

  Fly   462 TKLVSATPSLQSILPPDLPSDDGALQEEIAKLQEKMTIQQKEVES----------RIAEQLEEEQ 516
            .:...|...|:.:....|.:  .|.:..:.:|:|::::::.|:|.          ..|:..|..:
  Rat   480 LEKAQAERLLRELADNRLTT--VAEKSRVLQLEEELSLRRGEIEELQHCLLQSGPPPADHPEAAE 542

  Fly   517 RLRENVKYLNEQIATLQSELVSKDEAL--EKFSLSECGIENLRRELELLKEENEKQAQEAQAEFT 579
            .||     |.|::.:...| ..:|..|  :|:   |..::..:.|::.|:..|||.|||. |:..
  Rat   543 TLR-----LRERLLSASKE-HQRDSTLLQDKY---EHMLKTYQTEVDKLRAANEKYAQEV-ADLK 597

  Fly   580 RKLAEKSVEVLRLSSELQNLKATSDSLESERVNKTDECE-ILQTEVRMRDEQIRELNQQLDEVTT 643
            .|:.:.:.|.:.|   :.|.|:..|||.|:.....::.: .|.:....:.::|.||...::.:..
  Rat   598 AKVQQATTENMGL---MDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELKALVEGIKM 659

  Fly   644 QLNVQKADSSALDDMLRLQKEGTEEKSTLLEKTEKELVQSKEQAAKTLNDKEQLEKQISDLKQLA 708
            :..::..:..|..|:           .|.:...|||.::.|.|.|         :::::.|:|..
  Rat   660 EHQLELGNLQAKHDL-----------ETAMHGKEKEGLRQKLQEA---------QEELAGLQQHW 704

  Fly   709 EQEKLVREMTENAINQIQLEKESIEQQLALKQNELEDFQKKQSESEVHLQEIKAQNTQKDFELVE 773
                           :.|||:::.:.:|     ||::.|.:..::::.:||::.    .|.|...
  Rat   705 ---------------RAQLEEQASQHRL-----ELQEAQDQCRDAQLRVQELEG----LDVEYRG 745

  Fly   774 SGESLKKLQQQL---EQKTLGHEKLQAALEELKKEKETIIKEK----EQELQQLQSKSAESESAL 831
            ..::::.|::|:   |:|.|.:|.||.|..:.::|.|. ::||    |..||.::|..:...|  
  Rat   746 QAQAIEFLKEQISLAEKKMLDYEMLQRAEAQSRQEAER-LREKLLVAENRLQAVESLCSAQHS-- 807

  Fly   832 KVVQVQLEQLQQQAAASGEEGSKTVAKLHDEISQLKSQAEETQSELKSTQSNLEAKSKQLEAANG 896
            .|::                        .:::|:.|.:.:||   ::..|..|..:.|::.|   
  Rat   808 HVIE------------------------SNDLSEEKIRMKET---VEGLQDKLNKRDKEVAA--- 842

  Fly   897 SLEEEAKKSGHLLEQITKLKSEVGETQAALSSCHTDVESKTKQLEAANAALEKVNKEYAESRAEA 961
                       |..|:..|:::|...:....|....::|..|:.....|.||.|::         
  Rat   843 -----------LTSQMDMLRAQVSALENKCKSGEKKIDSLLKEKRRLEAELEAVSR--------- 887

  Fly   962 SDLQDKVKEITDTLHAELQAERSSSSALHTKLSKFSDEIATGHKELTSKADAWSQEMLQKEKELQ 1026
                              :...:|...:|.                       |||:|:||:.|.
  Rat   888 ------------------KTHDASGQLVHI-----------------------SQELLRKERSLN 911

  Fly  1027 ELRQQLQDSQD---------SQTKLKAEGERKEKSFEESIKNLQEEVTKAKTENLELSTGTQTTI 1082
            |||..|.::..         |:...|||...||:..::.|:.|:|::|....|. .||...:.::
  Rat   912 ELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGLDKEK-SLSEQKRYSL 975

  Fly  1083 KDLQERLEITNAELQHKEKMASEDAQKIA-----DLKTLVEAIQVAN------ANISATNAELST 1136
            .|.....|:  ..||| :.:::|||.:.|     .::.||||::..:      :|..:.|.    
  Rat   976 IDPASAPEL--LRLQH-QLVSTEDALRDALDQAQQVERLVEALRGCSDRTQTISNSGSANG---- 1033

  Fly  1137 VLEVLQAEKSETNH 1150
            :.:..:|.|.|..|
  Rat  1034 IHQPDKAHKQEDKH 1047

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625 35/63 (56%)
NIP100 237..815 CDD:227569 174/640 (27%)
CAP_GLY 240..306 CDD:279625 41/66 (62%)
Mplasa_alph_rch 592..1328 CDD:275316 116/588 (20%)
TMPIT 772..>882 CDD:285135 24/117 (21%)
TMPIT 1175..>1271 CDD:285135
BAR 1281..1466 CDD:299863
SHE3 1327..1541 CDD:293683
CLIP1_ZNF 1621..1638 CDD:293247
CLIP1_ZNF 1668..1684 CDD:293247
Clip2NP_068837.2 CAP_GLY 83..146 CDD:279625 35/63 (56%)
CAP_GLY 223..286 CDD:279625 41/66 (62%)
DUF4349 <380..485 CDD:305044 24/105 (23%)
mycoplas_twoTM 572..>658 CDD:275320 22/90 (24%)
Rab5-bind 587..885 CDD:286404 78/390 (20%)
TTKRSYEDQ <683..871 CDD:287216 51/265 (19%)
COG4372 776..>1032 CDD:226809 69/354 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5244
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 342 1.000 Inparanoid score I2236
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001218
OrthoInspector 1 1.000 T618767
orthoMCL 1 0.900 OOG5_130457
Panther 1 1.100 O PTHR18916
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
98.820

Return to query results.
Submit another query.