DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and tip1

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_593613.1 Gene:tip1 PomBaseID:SPAC3C7.12 Length:461 Species:Schizosaccharomyces pombe

Alignment Length:560 Identity:131/561 (23%)
Similarity:218/561 (39%) Gaps:168/561 (30%)


  Fly   239 VGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPS----GKNDGTVDDIRYFECK--PKY 297
            :|..|.|.:|   ..|.:||.||.:...|.:.|:|| .|.    |||.|.||...||:.|  .|.
pombe     4 LGSVVEVITG---ERGFVRYAGEVENRKGVYVGLEL-LPEFAEFGKNRGVVDGREYFKTKNNEKT 64

  Fly   298 GVFVPIAK------VSLSPSSKKTRLSRTGSRESL------------TSIGTMNSIATTATSRMR 344
            |:|||..|      :|.|||.|     ..|:..|:            :||..:.::  :::|.:.
pombe    65 GIFVPFDKCKLASSISSSPSPK-----IDGTAASIGMGFPPMSPNLQSSIPRLTNV--SSSSNLS 122

  Fly   345 MNAQQRKSSTPVKPILATPKSQFSMQDLLREKQQHVEKLMVERDLDREDAQNQAL-----QLQKN 404
            ||.....:.||.:.||     |..::|||.|:|.|.::|  |..|...| |.|:|     ..|..
pombe   123 MNTISSTALTPTEKIL-----QKRIEDLLYERQNHQQQL--EEVLATVD-QLQSLVTNFNDQQDE 179

  Fly   405 INELKARIVELESALDNERKKTEELQCSIDEAQFCGDE-LNAQSQVYKEKIHDLESKITKLVSAT 468
            ::||:.||...|..:...|.:..:.:........|.:| .|...:.|:.:|.:||:::...:|. 
pombe   180 VDELRERITLKEERIQQMRNEASQRRFEFKTTIECLEESSNRAIETYENRIAELEAQLEMYMSG- 243

  Fly   469 PSLQSILPPDLPSDDGALQEEIAKLQEKMTIQQKEVESRIAEQLEEEQRLRENVKYLNEQIATLQ 533
                       .|:|..|          .::||           |.:..|.: |:.|.|::.||.
pombe   244 -----------KSEDDLL----------FSLQQ-----------ERDYALNQ-VEILQERVDTLM 275

  Fly   534 SELVSKDEALEKFS--------LSECGIENLRRELELLKEENEKQAQEAQAEFTRKLAEKSVEVL 590
            .:..:...|.||.|        |:....|:.:|.    |..|:......|...|.:..|..:|||
pombe   276 KQKANSSTANEKLSHMESSSPTLTNASFESPKRG----KGSNDLPENHPQRRQTLEFYEIEIEVL 336

  Fly   591 RLSSELQNLKATSDSLESERVNKTDECEILQTEVRMRDEQIRELNQQLDEVTTQLNVQKADSSAL 655
            |  .:::.|:|.||.                     :|..|.:|.:.||                
pombe   337 R--EKVEKLQALSDE---------------------KDFYISKLEKSLD---------------- 362

  Fly   656 DDMLRLQKEGTEEKSTLLEKTEKELVQSKEQAAKTLNDKEQLEKQISDLKQLAEQEKLVREMTEN 720
                               :.:...|.|.|:.:....:||.|..:||:|              |:
pombe   363 -------------------RNDTTPVPSDEKLSNYAAEKENLVSRISEL--------------EH 394

  Fly   721 AINQIQLEKESIEQQLALKQNELEDFQK-KQSESEVHLQE 759
            .|.|:.:..|...::::..:.|||..|: ::::|:.|..|
pombe   395 TIEQLTINNERDNERMSPAEFELETTQEVEENDSDSHDDE 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625
NIP100 237..815 CDD:227569 131/561 (23%)
CAP_GLY 240..306 CDD:279625 29/78 (37%)
Mplasa_alph_rch 592..1328 CDD:275316 29/170 (17%)
TMPIT 772..>882 CDD:285135
TMPIT 1175..>1271 CDD:285135
BAR 1281..1466 CDD:299863
SHE3 1327..1541 CDD:293683
CLIP1_ZNF 1621..1638 CDD:293247
CLIP1_ZNF 1668..1684 CDD:293247
tip1NP_593613.1 CAP_GLY 4..74 CDD:214997 29/74 (39%)
FliE 101..>187 CDD:298840 27/96 (28%)
BBP1_C <140..238 CDD:291921 27/101 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001218
OrthoInspector 1 1.000 T1125358
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1398
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.