DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and Dctn1

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_031861.2 Gene:Dctn1 MGIID:107745 Length:1281 Species:Mus musculus

Alignment Length:1491 Identity:306/1492 (21%)
Similarity:565/1492 (38%) Gaps:436/1492 (29%)


  Fly   106 SAYTDNSSAVLT-ANTEQFIIGQRV-WLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCV 168
            |:.|.:.|.:.| |:.....:|.|| .:|....|.:|::|.|.||.|:|.||:|||..|||||.|
Mouse     9 SSRTPSGSRMSTEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTV 73

  Fly   169 SGKRYFQCEPKRGIFSRLTRLTTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLRSPGIGG 233
            .|::||.|:...|||.|.:::..:. .||.| |||   .:||.|         .|.:|:..|   
Mouse    74 QGRKYFTCDEGHGIFVRQSQIQVFE-DGADT-TSP---ETPDSS---------ASKVLKREG--- 121

  Fly   234 KNGMAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYG 298
                         :...::...||.|                                  |||. 
Mouse   122 -------------ADAAAKTSKLRGL----------------------------------KPKK- 138

  Fly   299 VFVPIAKVSLSPSSKKTRLSRTGSRESLTSIGTMNSIATTATSRMRMNAQQRKSSTPVK-----P 358
              .|.|:.:.:...|.||.:.||.....:|:|...|.:....|       ..:.|||.:     |
Mouse   139 --APTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELS-------SSEPSTPAQTPLAAP 194

  Fly   359 ILATPKSQFSMQDLLREKQQHVEKLMVERDLDREDAQNQALQLQKNINELKARIVELESALDNER 423
            |:.||.                        |....|........|....|:|::.:||..|:..|
Mouse   195 IIPTPA------------------------LTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLR 235

  Fly   424 KKTEELQCSIDEAQFCGDELNAQSQVYKEKIHDLESKITKLVSATPSLQSILPPDLPSDDGALQE 488
            .|..|.:..:.|.:        :.::..|::.:.:||                         :||
Mouse   236 LKRSEDKAKLKELE--------KHKIQLEQVQEWKSK-------------------------MQE 267

  Fly   489 EIAKLQEKMTIQQKEVESRIAEQLEEEQRLRENVKYLNE--QIATLQSELV-SKDEAL--EKFSL 548
            :.|.||.::    ||......|.||.::|..|.:....:  ::|||..|:. .:.|:|  |..:|
Mouse   268 QQADLQRRL----KEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEAL 328

  Fly   549 SECGIENLRRELELLKEENEKQAQEAQAEFTRKLAEKSVEVLRLSSELQNLKATSDSLESERVNK 613
            .| .::.|..:||:||.|.|::..:..|. :.:|.:...:..||...|..::..|.|.:.|.|. 
Mouse   329 KE-RVDELTTDLEILKAEIEEKGSDGAAS-SYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVK- 390

  Fly   614 TDECEILQTEVRMRDEQIRELNQQLDEVTTQLNVQKADSSALDDMLRLQKEGTEEKSTLLE-KTE 677
                  ||..:..:::::..:.||.:                    |||:|.::.:||:.| |.:
Mouse   391 ------LQKLMEKKNQELEVVRQQRE--------------------RLQEELSQAESTIDELKEQ 429

  Fly   678 KELVQSKEQAAKTLNDKE-QLEKQISDLKQLAEQEKLVREMTENAINQIQLEKESIEQQLALK-Q 740
            .:.....|:..:.|.|:. .||:::.:|::.....:.:.||.:      :|::.:.|.:|.|: |
Mouse   430 VDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMND------ELQENARETELELREQ 488

  Fly   741 NELEDFQKKQSESEVHLQEIKAQNTQKDFELVESGESLKKLQQQLEQKTLGHEKLQAALEELKKE 805
            .::...:.::::..|.    .||.|..|::     :::||.:|     ...|  ||....||..:
Mouse   489 LDMAGARVREAQKRVE----AAQETVADYQ-----QTIKKYRQ-----LTAH--LQDVNRELTNQ 537

  Fly   806 KETIIKEKEQ---ELQQLQSKSAESESALKVVQVQLEQLQQQAAASGEEGSKTVAKLHDEISQ-- 865
            :|..::.::|   |....:.|.||:::..|.::::|.|:  :.|.:....|...|.:.|...:  
Mouse   538 QEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQM--EVAQANRHMSLLTAFMPDSFLRPG 600

  Fly   866 ---------------------LKSQAEETQSELKSTQSNLEAKSKQLEAANGSLEEEAKKSGHLL 909
                                 ::.||:|        :.:|.....:.....|:..|:...:..|:
Mouse   601 GDHDCVLVLLLMPRLICKAELIRKQAQE--------KFDLSENCSERPGLRGAAGEQLSFAAGLV 657

  Fly   910 EQITKLKSEVGETQAALSSCHTDVESKTKQLEAANAA--------LEKVNKEYAESRAEASDLQD 966
            ..::.|::.:...:.|||.|..||..|...|....:|        :|.::|:..:.......|..
Mouse   658 YSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTK 722

  Fly   967 KVK--EITDTLHAELQAERSSSS-ALHTKLSKFSDEIATGHKELTSKADAWSQEM------LQKE 1022
            .:|  :...::|...|.|.|:.. |.|.|.::             |..|....|:      ||..
Mouse   723 AIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQ-------------SALDCMGVEVGRLRAFLQGG 774

  Fly  1023 KELQELRQQLQDSQDSQTKLKAEGERKEKSFEESIKNLQEEV--TKAKTENLELSTGTQT--TIK 1083
            :|..::...|:|.:.|.:..:           :..|.::..:  |.|......|:.|:|.  |:.
Mouse   775 QEATDIALLLRDLETSCSDTR-----------QFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLL 828

  Fly  1084 DLQERL--------EITNAELQHKEKMASEDAQKIADLKTLV----------------EAIQVAN 1124
            |.::.|        |:..|..|....:|..:...:|.|:.|.                |.::.:.
Mouse   829 DCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSC 893

  Fly  1125 ANISATNAELSTVLEVLQAEKSETNHIFELFEMEADMNSERLIEK-------VTGIKEELKETH- 1181
            ..:.:|..:|:|.::                  |.:.::||...|       ...::.|:.:.. 
Mouse   894 TILISTMNKLATAMQ------------------EGEYDAERPPSKPPPVELRAAALRAEITDAEG 940

  Fly  1182 --LQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDSVKQKEELVQNLE 1244
              |:|::|:...:||::.||              ...|:|:|....|..|:          :.|:
Mouse   941 LGLKLEDRETVIKELKKSLK--------------IKGEELSEANVRLSLLE----------KKLD 981

  Fly  1245 EKVRESSSIIEAQNTKLNESNVQLENKTSCLKETQDQL------LESQKKE-KQLQEEAAK---- 1298
            ...:::...||...|:|:|:...|..|....:||.|.|      ||::|.| ||.....:|    
Mouse   982 SAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIE 1046

  Fly  1299 ----------------LSGELQQVQEANGD----------IKDSLVKVEELVKVLEEKLQAATSQ 1337
                            ::||..|...|.|.          :|||        .:|.:::.|....
Mouse  1047 GLRGPPPSGIATLVSGIAGEEPQRGGAPGQAPGALPGPGLVKDS--------PLLLQQISAMRLH 1103

  Fly  1338 LDAQQATNKELQELLVKSQENEGNLQGESLAVTEKLQQL-------EQANGEL-KEALCQKENGL 1394
            :...|..|..|:...:|:          |||....|...       |...|.| ..||.:|.:.|
Mouse  1104 ISQLQHENSILRGAQMKA----------SLAALPPLHVAKLSLPPHEGPGGNLVAGALYRKTSQL 1158

  Fly  1395 KELQGKLDESNTVLESQKKSHNEIQDKLEQAQQKERTLQEETSKLAEQLSQLKQANEELQK 1455
            .|   ||::.:|        |..:.|    ..:.....:..:::|.||::|||..::.::|
Mouse  1159 LE---KLNQLST--------HTHVVD----ITRSSPAAKSPSAQLMEQVAQLKSLSDTIEK 1204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625 31/64 (48%)
NIP100 237..815 CDD:227569 115/591 (19%)
CAP_GLY 240..306 CDD:279625 8/66 (12%)
Mplasa_alph_rch 592..1328 CDD:275316 159/857 (19%)
TMPIT 772..>882 CDD:285135 24/136 (18%)
TMPIT 1175..>1271 CDD:285135 20/99 (20%)
BAR 1281..1466 CDD:299863 46/221 (21%)
SHE3 1327..1541 CDD:293683 30/138 (22%)
CLIP1_ZNF 1621..1638 CDD:293247
CLIP1_ZNF 1668..1684 CDD:293247
Dctn1NP_031861.2 CAP_GLY 30..94 CDD:279625 31/64 (48%)
CCDC144C 227..547 CDD:291576 86/408 (21%)
PCRF 246..>342 CDD:305100 28/134 (21%)
CASP_C 314..>455 CDD:285395 38/170 (22%)
Dynactin 525..805 CDD:289240 56/316 (18%)
Interaction with HPS6. {ECO:0000269|PubMed:25189619} 911..1281 73/352 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1398
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.