DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CLIP-190 and NBPF20

Sequence 1:NP_609835.2 Gene:CLIP-190 FlyBaseID:FBgn0020503 Length:1690 Species:Drosophila melanogaster
Sequence 2:NP_001265196.1 Gene:NBPF20 HGNCID:32000 Length:5207 Species:Homo sapiens

Alignment Length:1693 Identity:334/1694 (20%)
Similarity:583/1694 (34%) Gaps:515/1694 (30%)


  Fly   276 EPSGKNDGTVDDIRYFECKPKY-GVFVPIAKVSLSPSSKKTRLSRTGSRESLTSIGTMNSIATTA 339
            :|.|.:        ::..:.|: |..:.:.::......||.| .|...:|               
Human   433 QPYGSS--------FYALEEKHVGFSLDVGEIEKKGKGKKRR-GRRSKKE--------------- 473

  Fly   340 TSRMRMNAQQRKSSTPVKPILATPKSQFSMQDLLREKQQHVEKLMVERD-------LDREDA--- 394
              |.|...:..:...|..|.|:        ::||.||...|.:..::|.       |:..|:   
Human   474 --RRRGRKEGEEDQNPPCPRLS--------RELLDEKGPEVLQDSLDRSYSTPSGCLELTDSCQP 528

  Fly   395 --------QNQALQLQKNINELKARIVELESALDN----------ERKKTEELQCSIDEAQFCGD 441
                    :.|.:.|..:::|:: :..|:|...|.          :.|:.|.||.|:|.......
Human   529 YRSAFYVLEQQRVGLAVDMDEIE-KYQEVEEDQDPSCPRLSRELLDEKEPEVLQDSLDRCYSTPS 592

  Fly   442 ---ELNAQSQVYKEKIHDLESKITKLVSATPSLQSILPPDLPSDDGALQEEIAKLQEKMTIQQKE 503
               ||....|.|...::.||.:...|.         |..|....|   |||    :|........
Human   593 GYLELPDLGQPYSSAVYSLEEQYLGLA---------LDVDRTKKD---QEE----EEDQGPPCPR 641

  Fly   504 VESRIAEQLEEEQRLRENVKYLNEQIATLQSELVSKDE---------ALEK----FSLSECGIE- 554
            :...:.|.:|.|. |:::   |:...:|..|.|...|.         |||:    |||....|| 
Human   642 LSRELLEVVEPEV-LQDS---LDRCYSTPSSCLEQPDSCQPYGSSFYALEEKHVGFSLDVGEIEK 702

  Fly   555 ----NLRRELELLKE--ENEKQAQEAQ----AEFTRKLA-EKSVEVLRLSSELQNLKATSDSLE- 607
                ..||.....||  ...|:.:|.|    ...:|:|. ||..|||:            |||: 
Human   703 KGKGKKRRGRRSKKERRRGRKEGEEDQNPPCPRLSRELLDEKGPEVLQ------------DSLDR 755

  Fly   608 -----SERVNKTDECEILQTEVRMRDEQIRELNQQLDEVTTQLNVQKADSSALDDMLRLQKEGTE 667
                 |..:..||.|:..::...:.::|...|...:||:.....|::....:..   ||.:|   
Human   756 CYSTPSGCLELTDSCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVEEDQDPSCP---RLSRE--- 814

  Fly   668 EKSTLLEKTEKELVQS-----------------------------KEQ-------AAKTLNDKEQ 696
                ||::.|.|::|.                             :||       ..:|..|:|:
Human   815 ----LLDEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYSSAVYSLEEQYLGLALDVDRTKKDQEE 875

  Fly   697 LEKQISDLKQLAEQEKLVREMTENAINQIQLEK------ESIEQQ-------------------L 736
            .|.|.....:|:.:   :.|:.|..:.|..|::      ..:||.                   .
Human   876 EEDQGPPCPRLSRE---LLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQPYGSSFYALEEKHVGF 937

  Fly   737 ALKQNELEDFQK-----------------KQSESEVH---------LQEIKAQNTQKD------- 768
            :|...|:|...|                 |:.|.:.:         |.:.|.....:|       
Human   938 SLDVGEIEKKGKGKKRRGRRSKKERRRGRKEGEEDQNPPCPRLSRELLDEKGPEVLQDSLDRSYS 1002

  Fly   769 -----FELVESGESLKKLQQQLEQKTLGHEKLQAALEELKKEKETIIKEKEQELQQLQSKSAESE 828
                 .||.:|.:..:.....|||:.:|   |...::|::|.:|  ::|.:.......|:....|
Human  1003 TPSGCLELTDSCQPYRSAFYVLEQQRVG---LAVDMDEIEKYQE--VEEDQDPSCPRLSRELLDE 1062

  Fly   829 SALKVVQVQLEQLQQQAAA------SGEEGSKTVAKLHDEISQLKSQAEETQSELKSTQSN---L 884
            ...:|:|..|::.....:.      .|:..|..|..|.::...|....:.|:.:.:..:..   .
Human  1063 KEPEVLQDSLDRCYSTPSGYLELPDLGQPYSSAVYSLEEQYLGLALDVDRTKKDQEEEEDQGPPC 1127

  Fly   885 EAKSKQL------EAANGSLEEEAKKSGHLLEQITKLKSEVGETQAALSSCHT-------DVESK 936
            ...|::|      |....||:.........|||....: ..|.:..||...|.       ::|.|
Human  1128 PRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQ-PYGSSFYALEEKHVGFSLDVGEIEKK 1191

  Fly   937 TKQLEAANAALEKVNKEYAESRAEASD---------------------LQDKVK----------E 970
            .|..:...   .:..||....|.|..:                     |||.:.          |
Human  1192 GKGKKRRG---RRSKKERRRGRKEGEEDQNPPCPRLSRELLDEKGPEVLQDSLDRSYSTPSGCLE 1253

  Fly   971 ITDTLHAELQAERSSSSALHTK---LSKFSDEIATGHKELTSKAD----AWSQEML-QKEKELQE 1027
            :||:    .|..||:...|..:   |:...|||.. ::|:....|    ..|:|:| :||.|:  
Human  1254 LTDS----CQPYRSAFYVLEQQRVGLAVDMDEIEK-YQEVEEDQDPSCPRLSRELLDEKEPEV-- 1311

  Fly  1028 LRQQLQDSQD-------SQTKLKAEGERKEKSFEESIKNLQEEVTKAKTENLELSTGTQTTIKDL 1085
                ||||.|       ...:|...|:    .:..::.:|:|:.       |.|:.....|.||.
Human  1312 ----LQDSLDRCYSTPSGYLELPDLGQ----PYSSAVYSLEEQY-------LGLALDVDRTKKDQ 1361

  Fly  1086 QERLEITNAELQHKEKMASEDAQKIADLKTLVEAIQVANANISATNAE--LSTVLEVLQAEKSET 1148
            :|                 |:.|.....:...|.::|....:...:.:  .||....|:...|..
Human  1362 EE-----------------EEDQGPPCPRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQ 1409

  Fly  1149 NHIFELFEMEADMNSERLIEKVTGIKEELKETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQ 1213
            .:....:.:|         ||..|...::.|    ::::.|..:....:.|:.::..:|..:|.|
Human  1410 PYGSSFYALE---------EKHVGFSLDVGE----IEKKGKGKKRRGRRSKKERRRGRKEGEEDQ 1461

  Fly  1214 T------SKEKLTEIQQSLQELQDSVKQKEELVQNLEEKVRESSSIIEAQNT--KLNESNVQLEN 1270
            |      |:|.|.|            |..|.|..:|:......|..:|..::  ....:...||.
Human  1462 TPPCPRLSRELLDE------------KGPEVLQDSLDRSYSTPSGCLELTDSCQPYRSAFYVLEQ 1514

  Fly  1271 KTSCLKETQDQLLESQKKEKQLQEEAAKLSGELQQVQEANGDIKDSL----------VKVEEL-- 1323
            :...|....|::.:.|:.|:.......:||.||...:|.. .::|||          :::.:|  
Human  1515 QRVGLAVDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPE-VLQDSLDRCYSTPSGYLELPDLGQ 1578

  Fly  1324 -----VKVLEEKLQAATSQLDAQQATNKELQELLVKSQENEG----NLQGESLAVTEK--LQQ-- 1375
                 |..|||:.......:|   .|.|:.:|     :|::|    .|..|.|.|.|.  ||.  
Human  1579 PYSSAVYSLEEQYLGLALDVD---RTKKDQEE-----EEDQGPPCPRLSRELLEVVEPEVLQDSL 1635

  Fly  1376 ----------LEQAN-----GELKEALCQKENGLKELQGKLDESNTVLESQKKSHNEIQDKLEQA 1425
                      |||.:     |....||.:|..|.....|::::..    ..||.......|..:.
Human  1636 DRCYSTPSSCLEQPDSCQPYGSSFYALEEKHVGFSLDVGEIEKKG----KGKKRRGRRSKKERRR 1696

  Fly  1426 QQKERTLQEETSKLAEQLSQLKQANEELQKSLQQKQLLLEKGNEFDTQLAEYQKVIDEMDDAASV 1490
            .:||.  :|:.:....:||               ::||.|||.|.         :.|.:|.:.|.
Human  1697 GRKEG--EEDQNPPCPRLS---------------RELLDEKGPEV---------LQDSLDRSYST 1735

  Fly  1491 KSALLEQLQNRVAELETALRQANDAQKTAY--LETKELRRQLESLELEKSREVLSLKAQMNGASS 1553
            .|..||            |..:....::|:  ||.:.:...::..|:||.:||   :...:.:..
Human  1736 PSGCLE------------LTDSCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEV---EEDQDPSCP 1785

  Fly  1554 RSGKG--DEVESLDIETSLAKINFLNSIIADMQQKNDALKAKVQTLE------TLPMDFTKPHAF 1610
            |..:.  ||.|...::.||.:.....|...::........:.|.:||      .|.:|.||....
Human  1786 RLSRELLDEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYSSAVYSLEEQYLGLALDVDRTKKDQE 1850

  Fly  1611 DALTKRKPAPRLFCDICDEFDQHDTEDCPIQGSEDQDYSTPSSESNNNEKERKLPAPRKYCDSCE 1675
            :...:..|.|||..::.:.     .|...:|.|.|:.||||||         .|..|    |||:
Human  1851 EEEDQGPPCPRLSRELLEV-----VEPEVLQDSLDRCYSTPSS---------CLEQP----DSCQ 1897

  Fly  1676 VFG 1678
            .:|
Human  1898 PYG 1900

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_609835.2 CAP_GLY 126..189 CDD:279625
NIP100 237..815 CDD:227569 134/701 (19%)
CAP_GLY 240..306 CDD:279625 4/31 (13%)
Mplasa_alph_rch 592..1328 CDD:275316 168/936 (18%)
TMPIT 772..>882 CDD:285135 21/116 (18%)
TMPIT 1175..>1271 CDD:285135 19/104 (18%)
BAR 1281..1466 CDD:299863 48/225 (21%)
SHE3 1327..1541 CDD:293683 53/239 (22%)
CLIP1_ZNF 1621..1638 CDD:293247 3/17 (18%)
CLIP1_ZNF 1668..1684 CDD:293247 4/12 (33%)
NBPF20NP_001265196.1 DUF1220 3..57 CDD:310992
DUF1220 67..132 CDD:310992
DUF1220 142..207 CDD:310992
DUF1220 240..301 CDD:310992
DUF1220 311..376 CDD:310992
DUF1220 386..451 CDD:310992 4/26 (15%)
DUF1220 484..545 CDD:310992 13/69 (19%)
DUF1220 555..620 CDD:310992 16/74 (22%)
DUF1220 630..695 CDD:310992 17/73 (23%)
DUF1220 728..789 CDD:310992 17/73 (23%)
DUF1220 799..864 CDD:310992 11/75 (15%)
DUF1220 874..939 CDD:310992 10/68 (15%)
DUF1220 972..1033 CDD:310992 11/64 (17%)
DUF1220 1043..1108 CDD:310992 12/67 (18%)
DUF1220 1118..1183 CDD:310992 12/66 (18%)
DUF1220 1216..1277 CDD:310992 11/65 (17%)
DUF1220 1287..1352 CDD:310992 19/82 (23%)
DUF1220 1362..1427 CDD:310992 13/91 (14%)
DUF1220 1460..1521 CDD:310992 15/73 (21%)
DUF1220 1531..1596 CDD:310992 14/66 (21%)
DUF1220 1606..1671 CDD:310992 18/70 (26%)
DUF1220 1704..1765 CDD:310992 18/97 (19%)
DUF1220 1775..1840 CDD:310992 12/68 (18%)
DUF1220 1850..1915 CDD:310992 20/70 (29%)
DUF1220 1948..2009 CDD:310992
DUF1220 2019..2084 CDD:310992
DUF1220 2094..2159 CDD:310992
DUF1220 2192..2253 CDD:310992
DUF1220 2263..2328 CDD:310992
DUF1220 2338..2403 CDD:310992
DUF1220 2436..2497 CDD:310992
DUF1220 2507..2572 CDD:310992
DUF1220 2582..2647 CDD:310992
DUF1220 2680..2741 CDD:310992
DUF1220 2751..2816 CDD:310992
DUF1220 2826..2891 CDD:310992
DUF1220 2924..2985 CDD:310992
DUF1220 2995..3060 CDD:310992
DUF1220 3070..3135 CDD:310992
DUF1220 3168..3229 CDD:310992
DUF1220 3239..3304 CDD:310992
DUF1220 3314..3379 CDD:310992
DUF1220 3412..3473 CDD:310992
DUF1220 3483..3548 CDD:310992
DUF1220 3558..3623 CDD:310992
DUF1220 3656..3717 CDD:310992
DUF1220 3727..3792 CDD:310992
DUF1220 3802..3867 CDD:310992
DUF1220 3900..3961 CDD:310992
DUF1220 3971..4036 CDD:310992
DUF1220 4046..4111 CDD:310992
DUF1220 4144..4205 CDD:310992
DUF1220 4215..4280 CDD:310992
DUF1220 4290..4355 CDD:310992
DUF1220 4388..4449 CDD:310992
DUF1220 4459..4524 CDD:310992
DUF1220 4557..4618 CDD:310992
DUF1220 4628..4693 CDD:310992
DUF1220 4703..4768 CDD:310992
DUF1220 4778..4843 CDD:310992
DUF1220 4876..4937 CDD:310992
DUF1220 4947..5012 CDD:310992
DUF1220 5022..5087 CDD:310992
DUF1220 5120..5181 CDD:310992
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.