DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and GLC8

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_014042.1 Gene:GLC8 SGDID:S000004928 Length:229 Species:Saccharomyces cerevisiae

Alignment Length:123 Identity:30/124 (24%)
Similarity:44/124 (35%) Gaps:37/124 (30%)


  Fly    18 HSD--PYEVENESASSIKRETGEKVMSHKELMEKLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLE 80
            :||  |.:|.|:....:  ..||.....||     :|:     |||..:|     ::.||     
Yeast   141 NSDKKPCQVANDDIDDL--SLGEPEFEIKE-----NKQ-----PDFETND-----ENDED----- 183

  Fly    81 TIKERARRISFVRRRKLHYTEFSTVELARRLIREEFTESSESQLSVDDEHISEIAEEE 138
              ...||...|...||.||.           :|..|.:.|...|..:||...:...:|
Yeast   184 --SPEARHKKFEEMRKKHYD-----------VRAIFNKKSREALKDEDEDEDDSTTKE 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 21/90 (23%)
GLC8NP_014042.1 IPP-2 91..201 CDD:309902 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.