DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and I-2

DIOPT Version :10

Sequence 1:NP_609828.2 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_568768.1 Gene:I-2 / 835296 AraportID:AT5G52200 Length:191 Species:Arabidopsis thaliana


Alignment Length:168 Identity:31/168 - (18%)
Similarity:59/168 - (35%) Gaps:52/168 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RTRFDKMNLGVPVHSDPYEVENESASSIKRETGEKVMSHKELME-------------------KL 50
            |.::|:.|:          ||.||...::::..|....:..:|:                   :.
plant     8 RVQWDEANI----------VEIESNKPVRQKITEPKTPYHPMMDDDGSLSPRGRAFDECVDDMQR 62

  Fly    51 HKEVKLTTPDFFAHDP------------SCSSDDSEDFEFLETIKE---RARRISFVRRRKLHYT 100
            .:|::....|..|...            |.|.::.|:.:.::..:|   ..:...|...||.||.
plant    63 AEELRNVLNDAAASSSRNSSQGSGGGGWSSSDEEEEEADPMDQDEEGSGSGKNERFNAHRKAHYD 127

  Fly   101 EFSTVELAR---RLIREEFTE-----SSESQLSVDDEH 130
            ||..|:..|   ....||..|     .|:|:.:.:..|
plant   128 EFRKVKELRSSGSFYEEEEEEDDGAKGSKSETTTNSRH 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_609828.2 IPP-2 <18..115 CDD:461504 22/133 (17%)
I-2NP_568768.1 IPP-2 9..141 CDD:461504 24/141 (17%)

Return to query results.
Submit another query.