DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and PPP1R2C

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_079486.1 Gene:PPP1R2C / 80316 HGNCID:16324 Length:202 Species:Homo sapiens


Alignment Length:156 Identity:43/156 - (27%)
Similarity:67/156 - (42%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FDKMNLGVPVHSDPY-EVENESASSIKRETGE---KVMSHKELMEKLHKEVKLTTPDFFAHDPSC 68
            :|.|....|..|  | .|::....|::...||   :.:..||..:              |.|.||
Human    63 YDLMKANEPGTS--YMSVQDNGEDSVRDVEGEDSVRGVEGKEATD--------------ASDHSC 111

  Fly    69 SSDDSEDFE-FLETI---KERARRISFVRRRKLHYTEFSTVELARRL----IREEFTESSESQLS 125
            ..|:.|..| ::..|   |:..:| .|..||:|||.|...::|||:|    ::.|..|:.|:...
Human   112 EVDEQESSEAYMRKILLHKQEKKR-QFEMRRRLHYNEELNIKLARQLMWKELQSEDNENEETPQG 175

  Fly   126 VDDEHISEIAEEECPPCG---TDSDD 148
            .::|..:....||.|..|   |.|.|
Human   176 TNEEKTAAEESEEAPLTGGLQTQSCD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 27/97 (28%)
PPP1R2CNP_079486.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Required for binding PPP1CC. /evidence=ECO:0000250 12..17
Required for binding PPP1CC. /evidence=ECO:0000250 43..55
IPP-2 45..170 CDD:309902 34/123 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..118 14/62 (23%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 144..147 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..202 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.