DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and PPP1R2C

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_079486.1 Gene:PPP1R2C HGNCID:16324 Length:202 Species:Homo sapiens

Alignment Length:156 Identity:43/157 (27%)
Similarity:67/157 (43%) Gaps:32/157 (20%)


  Fly     8 FDKMNLGVPVHSDPY-EVENESASSIKRETGE---KVMSHKELMEKLHKEVKLTTPDFFAHDPSC 68
            :|.|....|..|  | .|::....|::...||   :.:..||..:              |.|.||
Human    63 YDLMKANEPGTS--YMSVQDNGEDSVRDVEGEDSVRGVEGKEATD--------------ASDHSC 111

  Fly    69 SSDDSEDFE-FLETI---KERARRISFVRRRKLHYTEFSTVELARRL----IREEFTESSESQLS 125
            ..|:.|..| ::..|   |:..:| .|..||:|||.|...::|||:|    ::.|..|:.|:...
Human   112 EVDEQESSEAYMRKILLHKQEKKR-QFEMRRRLHYNEELNIKLARQLMWKELQSEDNENEETPQG 175

  Fly   126 VDDEHISEIAEEECPPCG---TDSDD 148
            .::|..:....||.|..|   |.|.|
Human   176 TNEEKTAAEESEEAPLTGGLQTQSCD 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 27/98 (28%)
PPP1R2CNP_079486.1 Required for binding PPP1CC. {ECO:0000250} 12..17
Required for binding PPP1CC. {ECO:0000250} 43..55
IPP-2 45..170 CDD:309902 34/124 (27%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. {ECO:0000250} 144..147 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72063
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.