DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and Ppp1r2

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_080076.1 Gene:Ppp1r2 MGIID:1914099 Length:206 Species:Mus musculus

Alignment Length:172 Identity:44/173 (25%)
Similarity:76/173 (44%) Gaps:36/173 (21%)


  Fly     1 MTTKRTRFDKMNLGVPVH--------------SDPYE---VENESASSIKRETGEKVMSHKELME 48
            ::.|..::|:||:....|              :.||.   .::|.|.|  ...|.:||:...|.:
Mouse    41 LSKKSQKWDEMNILATYHPADKDYGLMKIDEPNTPYHNMIGDDEDAYS--DSEGNEVMTPDILAK 103

  Fly    49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
            || ...:.:.|.:...:...|.::..|.    :.:||.::..|..:|||||.|...::|||:||.
Mouse   104 KL-AAAEGSEPKYRTREQESSGEEDNDL----SPEEREKKRQFEMKRKLHYNEGLNIKLARQLIS 163

  Fly   114 EEFTESSESQLSVDDEHISEIAE------EECPPCGTDSDDL 149
            ::..:..|      ||.::|.|:      ||.....|.||.|
Mouse   164 KDLHDDDE------DEEMAETADGDSMNVEESSQGSTTSDHL 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 26/93 (28%)
Ppp1r2NP_080076.1 Required for binding PPP1CC 12..17
Required for binding the 'RVXF' binding groove of PPP1CC 44..56 4/12 (33%)
IPP-2 46..164 CDD:282789 32/125 (26%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity 148..151 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.