DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and ppp1r2

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_991231.1 Gene:ppp1r2 ZFINID:ZDB-GENE-040426-1814 Length:204 Species:Danio rerio

Alignment Length:166 Identity:44/167 (26%)
Similarity:68/167 (41%) Gaps:27/167 (16%)


  Fly     4 KRTRFDKMNLGVPVH--------------SDPYE---VENESASSIKRETGEKVMSHKELMEKLH 51
            |..::|:||:....|              |.||.   .:.|...::....|...:...:|.:||.
Zfish    44 KSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHRMVGDEEDEGALSDSEGNTALPGDDLAQKLA 108

  Fly    52 KEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEF 116
            ..........|..:|...|.:.|:.|.  :.:|:||:..|...||:||.|...::|||:||..|.
Zfish   109 AAAAEGAESRFMQEPEEESSEEEEEEL--SPEEQARKKQFQMMRKMHYNEGMNIKLARQLIANEL 171

  Fly   117 TESSESQLSVDDEHISEIAEEE----CPPCGTDSDD 148
            .|..|.    :||.:.:..|.|    .||...||.|
Zfish   172 EEEDED----EDEEMKDDTETEDITVDPPQDADSLD 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 24/93 (26%)
ppp1r2NP_991231.1 IPP-2 46..169 CDD:282789 31/125 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.