DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and I-2

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster


Alignment Length:158 Identity:45/158 - (28%)
Similarity:60/158 - (37%) Gaps:42/158 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRTRFDKMNLGVPVH--------------SDPY---EVENESASSIKRETGEKVMSHKELMEKLH 51
            |..:||::|:....|              ..||   |..:|:...:..|.         |:|||.
  Fly   135 KSAKFDELNVMQTFHPADKDYGHMKIDEPKTPYNYTEGFDENRDELDTEL---------LVEKLR 190

  Fly    52 KEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEF 116
            .............|...|.||....|     :||.||..|.||||.||.||..|:|||:||:|| 
  Fly   191 IAANTQPSTESIEDDGSSGDDQPLSE-----EERQRRREFERRRKAHYREFEAVKLARKLIQEE- 249

  Fly   117 TESSESQLSVDDEHISEIAEEECPPCGT 144
                      ||:...|....:..|.|:
  Fly   250 ----------DDDDDDEDKGADSRPSGS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 31/92 (34%)
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 36/123 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.