DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and I-2

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097564.1 Gene:I-2 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster

Alignment Length:158 Identity:45/159 (28%)
Similarity:60/159 (38%) Gaps:42/159 (26%)


  Fly     4 KRTRFDKMNLGVPVH--------------SDPY---EVENESASSIKRETGEKVMSHKELMEKLH 51
            |..:||::|:....|              ..||   |..:|:...:..|.         |:|||.
  Fly   135 KSAKFDELNVMQTFHPADKDYGHMKIDEPKTPYNYTEGFDENRDELDTEL---------LVEKLR 190

  Fly    52 KEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEF 116
            .............|...|.||....|     :||.||..|.||||.||.||..|:|||:||:|| 
  Fly   191 IAANTQPSTESIEDDGSSGDDQPLSE-----EERQRRREFERRRKAHYREFEAVKLARKLIQEE- 249

  Fly   117 TESSESQLSVDDEHISEIAEEECPPCGT 144
                      ||:...|....:..|.|:
  Fly   250 ----------DDDDDDEDKGADSRPSGS 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 31/93 (33%)
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 37/124 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4777803
eggNOG 1 0.900 E1_KOG4041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12398
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.