DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and CG6380

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001286009.1 Gene:CG6380 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster

Alignment Length:289 Identity:88/290 (30%)
Similarity:126/290 (43%) Gaps:57/290 (20%)


  Fly     4 KRTRFDKMNLGVPVHSDPYE-----VENESASSIKRETGEKVMSHKELMEKLHKEVKLTTPDFFA 63
            |..:||::|:....|....:     ::......:..|...|.:....|:|||....|...|.|..
  Fly    22 KAAKFDEVNILATFHPAGKDYGHMIIDEPKTPFVFEEDLPKELDTNALIEKLRHTSKSEMPAFGI 86

  Fly    64 HDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEFTESSESQLSVDD 128
            ...|..|...|||.  |:::|:.||:.|.||||:||.||.:|.||||||.:||.|.:.|:.::. 
  Fly    87 EGDSEESSADEDFP--ESVEEKVRRMEFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIH- 148

  Fly   129 EHISEIAEEECPPC-------GTDSDDLLPYFQYDRATDQSMISDDSLPKEDPEPGFHPAHHCYN 186
               .|...|.|..|       |..|:.....:.|..:..:..|||.|    :|||||.|:||||.
  Fly   149 ---CEGGMESCEACSENNQLDGEASNLTQTKYSYSESQSEYRISDHS----EPEPGFSPSHHCYQ 206

  Fly   187 KLISQTPDPPIVYVPAEPEP--------------QPEPQPEPPVEPRPEPEPEP-----EPETVL 232
            ||.::      ::..||||.              ..||..||.| |.|...|..     |.::.|
  Fly   207 KLKAE------LFSKAEPEELASLTHLHRMPSVNDDEPSREPRV-PYPSVVPTQTQNLHEHKSSL 264

  Fly   233 PPTA----PEVIDKTAPE-----EEKHTR 252
            ..|:    |..|.|:.|:     .:|.||
  Fly   265 KITSEKPTPARICKSNPDNRPGTSKKETR 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 32/95 (34%)
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 38/113 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4777792
eggNOG 1 0.900 E1_KOG4041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12398
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.