powered by:
Protein Alignment CG12620 and Ppp1r2
DIOPT Version :9
| Sequence 1: | NP_001260525.1 |
Gene: | CG12620 / 35034 |
FlyBaseID: | FBgn0032626 |
Length: | 287 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_620178.1 |
Gene: | Ppp1r2 / 192361 |
RGDID: | 621099 |
Length: | 205 |
Species: | Rattus norvegicus |
| Alignment Length: | 172 |
Identity: | 44/172 - (25%) |
| Similarity: | 74/172 - (43%) |
Gaps: | 36/172 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MTTKRTRFDKMNLGVPVH--------------SDPYE---VENESASSIKRETGEKVMSHKELME 48
::.|..::|:||:....| ..||. .::|...| ...|.:||:.:.|.:
Rat 40 LSKKSQKWDEMNILATYHPADKDYGLMKIDEPDTPYHNMIGDDEDVCS--DSEGNEVMTPEILAK 102
Fly 49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
|| ...:.:.|.|...:...|.::..|. :.:||.::..|..:|||||.|...::|||:||.
Rat 103 KL-AAAEGSEPKFRTREQESSGEEDNDL----SPEEREKKRQFEMKRKLHYNEGLNIKLARQLIS 162
Fly 114 EEFTESSESQLSVDDEHISEIAE------EECPPCGTDSDDL 149
::..:..| ||.:||.|: ||.....|..|.|
Rat 163 KDLHDDDE------DEEMSETADADSMNIEESNQGSTAGDHL 198
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4041 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1321970at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003529 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR12398 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.880 |
|
Return to query results.
Submit another query.