DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and Ppp1r2

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_620178.1 Gene:Ppp1r2 RGDID:621099 Length:205 Species:Rattus norvegicus

Alignment Length:172 Identity:44/173 (25%)
Similarity:74/173 (43%) Gaps:36/173 (21%)


  Fly     1 MTTKRTRFDKMNLGVPVH--------------SDPYE---VENESASSIKRETGEKVMSHKELME 48
            ::.|..::|:||:....|              ..||.   .::|...|  ...|.:||:.:.|.:
  Rat    40 LSKKSQKWDEMNILATYHPADKDYGLMKIDEPDTPYHNMIGDDEDVCS--DSEGNEVMTPEILAK 102

  Fly    49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
            || ...:.:.|.|...:...|.::..|.    :.:||.::..|..:|||||.|...::|||:||.
  Rat   103 KL-AAAEGSEPKFRTREQESSGEEDNDL----SPEEREKKRQFEMKRKLHYNEGLNIKLARQLIS 162

  Fly   114 EEFTESSESQLSVDDEHISEIAE------EECPPCGTDSDDL 149
            ::..:..|      ||.:||.|:      ||.....|..|.|
  Rat   163 KDLHDDDE------DEEMSETADADSMNIEESNQGSTAGDHL 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 26/93 (28%)
Ppp1r2NP_620178.1 Required for binding PPP1CC. {ECO:0000250} 12..17
Required for binding PPP1CC. {ECO:0000250} 43..55 4/12 (33%)
IPP-2 45..163 CDD:282789 32/125 (26%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. {ECO:0000250} 147..150 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12398
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.