DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and Ppp1r2

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_620178.1 Gene:Ppp1r2 / 192361 RGDID:621099 Length:205 Species:Rattus norvegicus


Alignment Length:172 Identity:44/172 - (25%)
Similarity:74/172 - (43%) Gaps:36/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTKRTRFDKMNLGVPVH--------------SDPYE---VENESASSIKRETGEKVMSHKELME 48
            ::.|..::|:||:....|              ..||.   .::|...|  ...|.:||:.:.|.:
  Rat    40 LSKKSQKWDEMNILATYHPADKDYGLMKIDEPDTPYHNMIGDDEDVCS--DSEGNEVMTPEILAK 102

  Fly    49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
            || ...:.:.|.|...:...|.::..|.    :.:||.::..|..:|||||.|...::|||:||.
  Rat   103 KL-AAAEGSEPKFRTREQESSGEEDNDL----SPEEREKKRQFEMKRKLHYNEGLNIKLARQLIS 162

  Fly   114 EEFTESSESQLSVDDEHISEIAE------EECPPCGTDSDDL 149
            ::..:..|      ||.:||.|:      ||.....|..|.|
  Rat   163 KDLHDDDE------DEEMSETADADSMNIEESNQGSTAGDHL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 26/92 (28%)
Ppp1r2NP_620178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 0/3 (0%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 4/11 (36%)
IPP-2 45..163 CDD:282789 32/124 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..142 8/42 (19%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 147..150 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..205 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.