DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and szy-2

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_498147.1 Gene:szy-2 WormBaseID:WBGene00021312 Length:193 Species:Caenorhabditis elegans

Alignment Length:131 Identity:34/132 (26%)
Similarity:46/132 (35%) Gaps:52/132 (39%)


  Fly     5 RTRFDKMNLGVPVH--------------SDPY-EVENESASSIKRETGEKVMSHKELMEKLHKEV 54
            |..||:||:....|              ..|| ..:.||      |..|.|:.           |
 Worm    51 RAHFDEMNILATYHPTDKDYGSMKIDEPKTPYHHSDGES------ECDEGVLG-----------V 98

  Fly    55 KLTTP---------------DFFAHDPS----CSSDDSEDFEFLETIKERARRISFVRRRKLHYT 100
            ..|.|               :..||..|    .|::||||...| |.::||.|..|.::|:.||.
 Worm    99 PTTRPRRVSLGNAIDPEKVAEGLAHPESGKSLSSAEDSEDEADL-TEEQRAHRRDFEKKRRAHYN 162

  Fly   101 E 101
            |
 Worm   163 E 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 28/102 (27%)
szy-2NP_498147.1 IPP-2 52..169 CDD:282789 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4777818
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.