DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12620 and PPP1R2B

Sequence 1:NP_001260525.1 Gene:CG12620 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_996740.2 Gene:PPP1R2B HGNCID:16318 Length:205 Species:Homo sapiens

Alignment Length:207 Identity:44/208 (21%)
Similarity:77/208 (37%) Gaps:59/208 (28%)


  Fly     1 MTTKRTRFDKMNLGVPVH--------------SDPYEV---ENESASSIKRETGEKVMSHKELME 48
            ::.|..::|::|:....|              |.||..   ::|.|.   |:|........:::.
Human    40 LSKKSQKWDEINILATYHPADKGYGLMKIDEPSPPYHSMMGDDEDAC---RDTETTEAMAPDILA 101

  Fly    49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
            |.....:...|.:...:...|.::..|.    :.:||.::..|..||||||.|...::|||:||.
Human   102 KKLAAAEGLEPKYRIQEQESSGEEDSDL----SPEEREKKRQFEMRRKLHYNEGLNIKLARQLIS 162

  Fly   114 EEFTESSESQLSVDDEHISEIAEEECPPCGTDSDDLLPYFQYDRATDQSMISDDSLPKEDPEPGF 178
            ::..:..|      ||.:.|.|:.|                             |:..|:...|.
Human   163 KDLHDDDE------DEEMLETADGE-----------------------------SMNTEESNQGS 192

  Fly   179 HPAHHCYNKLIS 190
            .|:....|||.|
Human   193 TPSDQQQNKLRS 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 23/93 (25%)
PPP1R2BNP_996740.2 Required for binding PPP1CC. {ECO:0000250} 12..17
Required for binding PPP1CC. {ECO:0000250} 43..55 3/12 (25%)
IPP-2 45..164 CDD:309902 29/126 (23%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. {ECO:0000250} 147..150 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1321970at2759
OrthoFinder 1 1.000 FOG0002873
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.