powered by:
                   
 
    
    
             
          
            Protein Alignment CG12620 and ppp1r2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001260525.1 | Gene: | CG12620 / 35034 | FlyBaseID: | FBgn0032626 | Length: | 287 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001163967.1 | Gene: | ppp1r2 / 100038193 | XenbaseID: | XB-GENE-479701 | Length: | 187 | Species: | Xenopus tropicalis | 
        
        
        
          
            | Alignment Length: | 151 | Identity: | 47/151 - (31%) | 
          
            | Similarity: | 70/151 -  (46%) | Gaps: | 27/151 - (17%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     4 KRTRFDKMNLGVPVHSDPYEVE------NESASSIKRETG---EKVMSHKELMEKLHKEV---KL 56|..::|:||:....|  |.:.:      :|.::...|..|   |..||..|..|.|..:|   ||
 Frog    42 KSQKWDEMNILATYH--PSDKDYGLMKIDEPSTPYHRMIGDDDEGAMSDSESNEDLTADVLAEKL 104
 
 
  Fly    57 -----TTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEF 116|.|.|.|..   .|.|.|:.|..|  :||.:|..|..:||.||.|...::|||:||.:|.
 Frog   105 AAAEGTDPKFLAQS---ESSDEEEEELTE--EEREKRKEFEMKRKHHYNEGMNIKLARQLIAKEL 164
 
 
  Fly   117 T-ESSESQLSVDDEHISEIAE 136. |..|.:  .:||.:.:|.:
 Frog   165 AGEVDEDE--DEDEEMQDITD 183
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | CG12620 | NP_001260525.1 | IPP-2 | <21..111 | CDD:282789 | 34/106 (32%) | 
          
            | ppp1r2 | NP_001163967.1 | IPP-2 | 44..158 | CDD:368219 | 37/120 (31%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 1 | 1.010 | - | - |  | D1321970at2759 | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0003529 | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.010 |  | 
        
      
           
             Return to query results.
             Submit another query.