DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tweek and RGD1307100

DIOPT Version :8

Sequence 1:NP_001286002.1 Gene:tweek / 35026 FlyBaseID:FBgn0261671 Length:5150 Species:Drosophila melanogaster
Sequence 2:XP_017446228.1 Gene:RGD1307100 / 294978 RGDID:1307100 Length:5094 Species:Rattus norvegicus

Alignment Length:5833 Identity:1786/5833 - (30%)
Similarity:2668/5833 - (45%) Gaps:1433/5833 - (24%)


  Fly     6 VEDTSDDSLPMGFPEVGTWNSTHNVSLNDMNLDARMIWLLASLLTTITWVTYITFYNSRVIGMLI 70
            ::...:||:.....::..:.:.||         :.::|||.:.:.:..|:.|:|:||||.:|:::
  Rat     1 MDQRKNDSIVPSITQLEDFLTEHN---------SNVVWLLVATILSCGWIIYLTYYNSRNVGLIL 56

  Fly    71 TKIANRWFIKGAYFKIGSVALNPLAGKIMFRDFVYITYDYTVRAQDGYFIFRWWRSYVPKDVSED 135
            |.:.||.: |..|..|||.:.:.|:||:|.|:..|||.|.:||.|||:.|||||:.|.||....|
  Rat    57 TLVLNRLY-KHGYIHIGSFSFSVLSGKVMVREIYYITEDMSVRIQDGFIIFRWWKMYNPKQKQHD 120

  Fly   136 LSHSDTRLSVQLNGYELHIYNRSDLYDTLEKTFGLEPSLLIPTDAASNEERNKLKEHHMNLENAR 200
             ..::|||.:.:|.:|.|:|||||||..|::.|||||:::.|     .::.:|.:|:    ...|
  Rat   121 -PKAETRLYITVNDFEFHVYNRSDLYGRLQELFGLEPTIIPP-----KKDDDKTREN----GRTR 175

  Fly   201 QSQRIQNVK-NSEAMQAT-TWRDLIPVIKIDVCSGRFVFGNRLTPTTLSISVEEAHCTYSTKPAV 263
            ...:|:.|| .:|:...| :||.||||||::|.:||..|||...|.||.|:.::|..||:|||..
  Rat   176 TQSKIERVKVKTESQDPTSSWRSLIPVIKVNVSTGRLAFGNHYQPQTLCINFDDAFLTYTTKPPS 240

  Fly   264 CRLDHFMHFVKAKVENAKVLFCPSPKYTGL-IDEPPRYMGEGFVVMMSNQMDLYFYMDEPGVVPE 327
            ..||.|||.||.|:||.:|:..|||:|.|| .|||||.||||||||.||.:|:|:||||||:|||
  Rat   241 SHLDQFMHIVKGKLENVRVMLVPSPRYVGLQNDEPPRLMGEGFVVMQSNDVDIYYYMDEPGLVPE 305

  Fly   328 HPVQIVLPNGDV------VEPSPPVWGINARCLRGTDFSYGPWADRQRDHLYRYFYPSDWKEAEV 386
            ...:.:  .|::      ::..||.||::..|.:||||:||||||||||.|:::|:|.|::..:|
  Rat   306 ETEESI--EGEISSEDCKLQDLPPCWGLDIVCGKGTDFNYGPWADRQRDCLWKFFFPPDYQVLKV 368

  Fly   387 TPTPQPGELRSYQSFDVTLCVLNEATIDILFSKEKETNAMHITVGPASYVEMTIPWVTQPDGYTS 451
            :...|||..|...:|::.:.::.:||||:||:|.:||||:|:.||..||:|:.||...:..|||.
  Rat   369 SEIAQPGRPRQILAFELRMNIIADATIDLLFTKNRETNAVHVNVGAGSYLEINIPMTVEESGYTP 433

  Fly   452 KIQGQLFHVEATTSLQYRSLAEFESLEYKVRIHYPTKWNAPQDWSISLSGCKTSAFIVYKHKCFF 516
            .|:|||.||:||||:|||:|.|.|.|.:.:...||..||.||.|...|...|.:...::..|.||
  Rat   434 AIKGQLLHVDATTSMQYRTLLEAEMLAFHINASYPRIWNMPQTWQCELEVYKATYHFIFAQKNFF 498

  Fly   517 QDLIEDWANKARPDILSFVPYTCNFSIRLHEFEILMLCNEYNWIDCSSANQENNHLAFCGDVFEM 581
            .|||:||::...|||.||||||.||.|..|:||::...|::||||||:..|||.:||.||:...:
  Rat   499 TDLIQDWSSDNAPDIFSFVPYTWNFKIMFHQFEMIWAANQHNWIDCSTKQQENVYLAACGETLNI 563

  Fly   582 SFALPFDDFLPKTVTLKFWIHGEGLDLSLYVPE-----------VSSVRPIVLAIDENARLLTRE 635
            .|:|||.||:|.|...:|.:.||.:||.|::|:           |.:..|..:|.:.......:.
  Rat   564 DFSLPFTDFVPATCNTRFSLRGEDVDLHLFLPDCHPSKYSLFMLVKNCHPNKMAAEAGVPAECQS 628

  Fly   636 GKLIRRPELYSKKWRKICQRSAGWIDCWAVPILALSIQYVYHPVPPLGPDPQADITTPEKEEILL 700
            |:...:|     |||.:.|..|||::||.||.:.|:|.|.:||:.|...|.|...:..|.||.:|
  Rat   629 GQKTVKP-----KWRNVTQEKAGWVECWTVPSVMLTIDYTWHPIYPQKADEQLKQSLSEMEETML 688

  Fly   701 SPMR-----IPKVRKSPVSSWQQPPEQYSKFDPGTLAADHVTVELEIG-SSVLMAYGNVLRNFIS 759
            |.:|     ..:|..||.:| .:||     .||..|..|.:.||:|:. .|.:..||.:|..|:.
  Rat   689 SVLRPAQKPSERVVSSPSTS-PRPP-----VDPSELPPDKLHVEMELSPDSQITLYGPLLNAFLC 747

  Fly   760 LKENIFGEDQNFTDMEQSNVNMKEPGVAQVNPKDQLLAKEKELANKSI---SETQPPEEKRKPFD 821
            :|||.||||..:.|.|:.   :..|.::        |:........::   |:.:..|...|...
  Rat   748 IKENYFGEDDMYMDFEEV---ISSPVLS--------LSTSSSSGWTAVGMDSDKRENESSAKSIH 801

  Fly   822 PRLYRPLEVMVSVIVHDIQAHVMKNCNEDDPPCPVVLIERFGFEMNKKYHETTLQVLVSPSYLLT 886
            |...||.::.|.|.::.:...:..:...|.|.||...:||..|||.|.:.||.||:::||..:..
  Rat   802 PLALRPWDITVLVNLYKVHGRLPVHGTTDGPECPAAFLERLCFEMKKGFRETMLQLVLSPLNVFV 866

  Fly   887 SD-CLQRSQREQHINQGHLMLSAVQVRGHAMFSNEGCALDEDTLEYSWLVEVQLGKLTGKLTLPQ 950
            || ..||...::.:.:||:.||.:|:|.|||||.||..|..|:|||:||::||.|.||.|:|.||
  Rat   867 SDNYQQRPPTDEVLREGHINLSGLQLRAHAMFSAEGLPLGSDSLEYAWLIDVQAGSLTAKVTAPQ 931

  Fly   951 LVNVVTGLETLILLAIDPENCLKSPKTVRNCHHGVPSNLCPQTKEEKKYK-----CPSSEDIKYK 1010
            |..::...:|.:...:..|..|:.||:|..|.||:....|     |.|..     ||:|:|:||.
  Rat   932 LACLLEWGQTFVFHVVCREYELERPKSVVICQHGIDRRFC-----ESKLSCIPGPCPTSDDLKYT 991

  Fly  1011 MTRVSVDAVDVYLIESGTALHAWISPIRLANCNLHGQRVKSGISGLLPSILLRLFMLHTTNSTFN 1075
            |||::||..|:|::|.|.|.:..:..:|:||||||.|.|..|:|..:....:|.::     ...:
  Rat   992 MTRLAVDGADIYIVEHGCATNIKMGAVRVANCNLHNQSVGEGVSAAVQDFEVRQYI-----EQLS 1051

  Fly  1076 TNTTGSNRSGKLRRADQDSLKSQDAGGSHYASHGKTGKRSSNSFSRRDSREEATRKLRGSFSETH 1140
            |..||. :...||||                                                  
  Rat  1052 TCRTGL-QPAVLRRA-------------------------------------------------- 1065

  Fly  1141 TKRTPETEITENWVEVGCTSLGPILLEGASALPIPDHELHLVQHNFLREHDAKFKRLWFLWSNNG 1205
                       .|:|.|..:||.|.::  .||....|..|..|.:||..|||:.|||||||.:: 
  Rat  1066 -----------YWLEAGSANLGLITVD--VALAADHHSKHEAQRHFLETHDARTKRLWFLWPDD- 1116

  Fly  1206 SALSSGSEISRCGCIGGCAFFGSNRNGQKFFK-----PTAQDAHDNYNIARYFIINNNKDFGFGE 1265
             .|.:....::|||:|||.|||....|..|||     |::..|..:        .:...|..:|:
  Rat  1117 -TLKNKRCRNKCGCLGGCRFFGGTVTGLDFFKLEELTPSSSSAFSS--------TSAESDMYYGQ 1172

  Fly  1266 SILHQGQ-LVFHTPPYSLHCVSLYDTADFNGKGRLYRPAGDLRNGSLKKTDLCSLPDGTKFKIGA 1329
            |:|..|: :|....|         .|.|.|                         .:|.|.|...
  Rat  1173 SLLQPGEWIVTKEVP---------KTVDGN-------------------------VNGMKRKEWE 1203

  Fly  1330 SGTTGVEKPEPNCRNKSRESIGSPNTLERRTKRYPCTRQTSVDVPYARLLDSPSKKLQLQHEASA 1394
            :.:.|:|.                   ||:      |:..|:.||......|.|.:     |.|:
  Rat  1204 NKSVGIEG-------------------ERK------TQHLSLQVPLRSHSSSSSSE-----ENSS 1238

  Fly  1395 GDAGSSHRRGSDSNRLRVSPPKTSISDSR------LTGDVLDD-ETEIPDEMSHSAPHSHPLEFE 1452
            ..|......|.     :.||  :|::|..      |.|...|| :..||.|:|.::|.|...:  
  Rat  1239 SSAAQPLLAGE-----KESP--SSVADGPAVQKEFLCGTKRDDGQASIPAEISGTSPVSPNTQ-- 1294

  Fly  1453 IADIALHVQGLGGDQLPREVQR-----------TISLTS-----ENPSEMFFSAEEDIS----NV 1497
                   .:.:|...|...::|           |.|||:     :.|..:......|:|    ||
  Rat  1295 -------DKSVGQSPLRSPLKRQASVCSTRLGSTKSLTAAFYGDKQPVTVGVQFSSDVSRSDENV 1352

  Fly  1498 LSQRGSMKQRNSVNSGSVVLSGKKRF-----SSDLSIGAQNDNGSHTLPTYRSDLE----IHAPD 1553
            |.   |.|||.|..|.....|.....     |.|.|:...:..      .|.|..|    |.:.:
  Rat  1353 LD---SPKQRRSFGSFPYTPSADSNSFHQYRSMDSSMSMADSE------AYFSAAEEFEPISSDE 1408

  Fly  1554 GNKTLPKRPQSTTELNE-DARR---IHGLATPI----RKITNISSRPEYRHFVHDADSRGSSSGT 1610
            |..|.|.|.:...::.: |..|   .|.:..|:    ..||:..:.|...|              
  Rat  1409 GPGTYPGRKKKKKQMQQIDYSRGSIYHSVEGPLTVHGEGITDPRTLPFKTH-------------- 1459

  Fly  1611 PSLSSNSFISAMSSQEDVALVNLH----------QQV--NRPIIDSPLLMASYLNHLSQVKCFNW 1663
            ||.:  ||:||:..:::| :.:|:          :||  .:|:      |:.|..:|:|.:..||
  Rat  1460 PSQA--SFVSALGGEDEV-IEHLYIVEGEKTGDTEQVTSQQPV------MSCYQTYLTQFQVVNW 1515

  Fly  1664 ------------NGCSFPLGPDVFSTPLFSENEDGGLTYIGSKMLPHFDLYSCWREIK------- 1709
                        :....||..|   ||...|:...    .....:|.|      :.||       
  Rat  1516 SVKHPTNKRTSKSSLHRPLDLD---TPTSEESSSS----FEQLCVPTF------KVIKQGLTANS 1567

  Fly  1710 VVPRYENATGSNSSATFMGGPKSHPWDPSVLLKEEESDKTTNGFDDGEFMSLQAEGGAVCTSVVA 1774
            ::.|....:||.|:..:.      |.|..::  :...|:|..     |..:|........|:.:.
  Rat  1568 LLDRGMQLSGSTSNTPYT------PLDKKIV--DNTDDETLT-----EEWALDQPVAQTKTTAIV 1619

  Fly  1775 RLKGQLNVFLTPLLLEGLQRMVEAAVPTIQSMHLLSVVNFIHTSCIAKVNNDNILKRDQSLSYWS 1839
            .:||.::|.||||:.|.|.|.:||.|....:.|..::|:.:||..:.:...::.....::||...
  Rat  1620 EVKGTVDVVLTPLVAEALDRYIEAMVHCASTRHPAAIVDDLHTKVLREAVQNSKTTFSENLSPKQ 1684

  Fly  1840 QVHSNSKRSTTERHLQGPGDSFLSD----VYEESISTK-TQGLIVLPKVSITMLQSSIVEEIISV 1899
            .:    :.|.||..:.|..:...:.    ..::|::.| .|..:.:|||::.:||:|:.|...:|
  Rat  1685 DI----RGSKTEHPMIGTTNQGQTQTNATTKQDSVTIKGLQANVSIPKVNLCLLQASVEESPATV 1745

  Fly  1900 AALDNVQDLSCVSLLTFYMEGISTKFHMGK-----------TTRASMHNVYI----QQTVQSGSS 1949
            .:    :.::.|||:....:.|:|:..|.:           :::.|..:.|:    .|...|||.
  Rat  1746 PS----RSVTHVSLVALCFDRIATQVRMNRGVVEETANNVDSSKTSNFDRYVHASKMQPQSSGSL 1806

  Fly  1950 NKKGGIMKGTRALLAHLSSQTRPDNVQGEPILIETSEKQLEEVVITLDIGRAHAQLRRLKTEGQS 2014
            ....|..:|                               :|:...|:|.|.|.|||.|.|    
  Rat  1807 RSNAGAERG-------------------------------KEIAAKLNIHRVHGQLRGLDT---- 1836

  Fly  2015 CTQDSPIIVTAIPEHKSKVLFECLKMPESTGI------------------ESIGYIMFECGLEGV 2061
             |......:||||..||||||...::.|.|.:                  |..|:||||||||.:
  Rat  1837 -TDIGTCAITAIPFEKSKVLFTLEELDEFTFVDETDQQAIPDVTRIGPSQEKWGWIMFECGLENL 1900

  Fly  2062 GVKIVKRSHFEKSENSKEELAEMAGAGAGGGASAGGFNLNDLVGQGEGAAGSGDGGATSKAEAAW 2126
            .:|                          ||..:|....|.....|:.......|..||..    
  Rat  1901 TIK--------------------------GGRQSGAVLYNSFGIMGKTNVTERGGVLTSNN---- 1935

  Fly  2127 RLITKKPPT----------PKTPKEKFQPASDSNISAETSGAEKGKSTPKPPDEDVEKGTSPANA 2181
               :...||          ...|.::..|:||.|          |.|.....||.||        
  Rat  1936 ---SSDSPTGSGYNTDVSDDNLPCDRTSPSSDIN----------GNSVSDEQDEGVE-------- 1979

  Fly  2182 QTGAQKPSAGAGTNTKDNYDKVLSNVKETDKTSSCVIELKAVWFNFAAP-----PCVPITRKIDL 2241
                           .|:..|.|..:.....:.|..:.:|.:||:||||     |....:|::  
  Rat  1980 ---------------SDDLKKDLPLMPPPPDSCSMKLTIKEIWFSFAAPTNVRSPAHAFSRQL-- 2027

  Fly  2242 TRLDWNLLSTASPAITAWMNPSNRLAMKIVSLMKALHTRQTAVAACLMAEAMDNEKIQRNPKIKK 2306
                 ||||||:||:.:|:.|.::|...:..|......|..||..|:|.||::|:.:...   .:
  Rat  2028 -----NLLSTATPAVGSWLVPIDQLKSSLNKLDTEGTLRICAVMGCIMTEALENKSVHFP---LR 2084

  Fly  2307 SRYANNYTLLSKTLQEDPSCQLCYIMQKLVLDEGVQRIETIFKQHDVPHLNTLRQGIIVLSRQWK 2371
            |:| |..|.:::.|||:|||.||.|:...:.......|:.......:|.|.||::|::.|:|||.
  Rat  2085 SKY-NRLTKVARFLQENPSCLLCNILHHYLHQANYSIIDDATMSDGLPALVTLKKGLVALARQWM 2148

  Fly  2372 NTLYNPILFEHQYKNKLSRPINVTFSFPQNEEDAENDECEG-DVEMGAFAGVGENPEE------- 2428
            ..:.....|:....::.::|:.     |....|.|::|..| |...|..:....:..|       
  Rat  2149 KFIVVTPAFKGVSLHRPAQPLK-----PPAAVDHEHEEGLGLDNGGGLQSDTSADGAEFEFDAAT 2208

  Fly  2429 -SENALLLGQTQHH---------------------RTHIGATYGHEGAN--HGTA-SQRSTSTSP 2468
             ||:.:||..|.:.                     .||..:....:|.:  |..: :...|:|..
  Rat  2209 VSEHTMLLEGTANRPPPGGSGPVTGAEIMRKLSKTHTHSDSALKIKGIHPYHSLSYTSGDTATDS 2273

  Fly  2469 NIHHPRRGLNKVHS--KASNYSHGNSSRSSIQMLPIISGQVPEFEYGALQEGSLSST-NSVNKSW 2530
            .:|..|.|:....|  |.|..|:...|..|:..|  :.| .|:....|::..||:.| |:|....
  Rat  2274 PVHVGRAGMPVKESPRKESLLSYLTGSFPSLHNL--LEG-TPQRSSAAVKSSSLTRTGNTVATDM 2335

  Fly  2531 LG-----TENHKEDLYFWMAKQQDNK-----KKHFTEKEHAR---------PAPPKMTE------ 2570
            |.     :|......|.||:....|:     :...|:..|..         |..|..::      
  Rat  2336 LSEHPLLSEPSSVSFYNWMSNAVGNRGSVVQESPVTKSGHNSLPTGVAPNLPTIPSASDFNTVLS 2400

  Fly  2571 ---------HAGQTRS-----GIMQ-----DSIKLLDAHLIFEPLLTCLGVMPQQMINKFSNADI 2616
                     |:..:.|     |:.:     .:::|.||.::|:|||:..|:..|..:      .:
  Rat  2401 SDQNTLDGTHSQHSTSQDDVAGVEEANQGFPAVQLADAQVVFKPLLSHTGIQSQDTM------PL 2459

  Fly  2617 SSLENFGTNLSLIGTFDSIRVDIVVSE-AGDKKNS-AQKPAKLNKKSNGGRASIMMDTPLFLCER 2679
            .....||.:||..||.|.:|.|||.|: |.|:|.. |::...:|......:.::|::|       
  Rat  2460 CYRMYFGEHLSFSGTLDCLRADIVDSDTAKDRKGKRARRQGHVNLPPLEFKPALMLET------- 2517

  Fly  2680 VGVELEVLKMSDGMVDQARQNVIYMSRRQLKK--HTSTVINFSLNVRFISQQVNMPLLRLLHQIC 2742
            ..:...|::.|   |...:.:...:|...|.|  :.:...||:::.:.|||.|:|.|:||:||..
  Rat  2518 FSISAVVMEKS---VCTPQNSTSALSFHDLNKRYYNTFHCNFTISCQSISQHVDMALVRLIHQFS 2579

  Fly  2743 NMYQNVKDAQNEFHDQPELSKKSQTKDECSLASEPTDIVPFNSMSERYNHAENYSDERYDKFNET 2807
            .|..::|..|.:.    :||:.:..    |.:..||    |.:...|...:.::|.......|  
  Rat  2580 TMIDDIKATQTDI----KLSRYTAG----SASPTPT----FKTRKHRDFRSSDFSRSSRGSLN-- 2630

  Fly  2808 MPTMLARPRPGGLAPIIQLTPSPNAKN-RPQSFAQKLRSTGKSVKGK--LGYTNLNESSSSPLRD 2869
                      ||       ....|||| |..|...|..|..|:..|:  ...:.::...|..:.|
  Rat  2631 ----------GG-------NRVNNAKNKRANSENNKKESRNKNSLGRSERRTSKVSRKGSKDVVD 2678

  Fly  2870 SPTMSLHEHNILKMSTESKASLNGACATSVSGDYQNTLTKAGMPTMAPMLETPNCWKTIYHLLEL 2934
            ..|:.:.:.:.:.:|.:|:.|                               ..||:.:|.||..
  Rat  2679 HMTIHMDDSDSITVSEQSEPS-------------------------------AECWQNMYKLLNF 2712

  Fly  2935 YGTMPETKTVVQRSSLNEHKSKSAG------------FAHDDDDLASAPTPLPQHREMLLVDASS 2987
            |..:.:...::::||   .....||            |.::.|..:...|    .|:..||.|..
  Rat  2713 YSLISDPTGILEKSS---ETFGPAGVRSPTEPTCRVVFENEQDSNSLTKT----QRKRSLVTAEP 2770

  Fly  2988 QERTRLIVFGVAKIHKTRLLATLSGLKLESEITTLNSTATWRKKARPV----SLECSLTGQVGRA 3048
            |..| |||||:..:::|.|.|.:.||.:|||:..::.:.|.::|.:.|    ..|...|..:|..
  Rat  2771 QHVT-LIVFGIGMVNRTHLEADIGGLTMESELKRIHGSFTLKEKMKDVLHQKMTETCATAHIGGV 2834

  Fly  3049 MIVLLEGVAPSQQ-----------------TVVKVTVGKSQTLYSSLSKRG-KDKNSGLLSIGAV 3095
            .||||||:.|:.|                 ||||.::.|||.|||  ::|| |..|:.:..:||:
  Rat  2835 NIVLLEGITPNIQLEDFPTSPTSTAKQEFLTVVKCSIAKSQALYS--AQRGLKTNNAAVFKVGAI 2897

  Fly  3096 NIDIPQHPVALHGMMTRSSKQLSSTLQELRVKRNSGRSTMRSHTAEEPESPFHARNSVGASSGTG 3160
            :|:|||||..||.||.|||.|||..:.:| :::.|        ||.:|         |.....|.
  Rat  2898 SINIPQHPATLHSMMVRSSHQLSKQISDL-IRQPS--------TAPQP---------VKEDIATP 2944

  Fly  3161 VASEMRERTVSGGAGAQQQPQQAARRAAHMAQSKTGTAQHQNGLLQPLVMQFNVLLQSLSINAAL 3225
            :.||....:|:          |.........|...|..:      :|:|::|:.:|..::|.|||
  Rat  2945 LPSEKTPTSVN----------QTPIETNEFPQLPEGLEK------KPIVLKFSAMLDGIAIGAAL 2993

  Fly  3226 LPSLQAQYRMNHVSSMGVTGQRAKFVIDLPTHTLSFNTKIQ-NEMN-LPSEACIGLPPVHVLAEY 3288
            ||||:|:|:|..:.|.|:||.:.:|..:||.|.|.|.:|:. .:|: :|..|.:.||||.:..:|
  Rat  2994 LPSLKAEYKMGRMRSHGMTGAQTRFTFELPNHRLRFTSKVSATDMSTIPPSASLNLPPVTMSGKY 3058

  Fly  3289 IPDHRQDHTENV---------EGIVLRQGGYVNASAEIGEFERCLTTDLLNHLVFVQKVFMREIN 3344
            |.:....:::.|         :|..| ||.|:...||:|.||..|||||||||||||||||:|:|
  Rat  3059 IMEEHDSYSDQVWSIDELPSKQGYYL-QGNYLRCVAEVGSFEHNLTTDLLNHLVFVQKVFMKEVN 3122

  Fly  3345 EVLQKVYGGEKPVPLWTEESGDSSGAVQESSLKRILFSINISMKRIQLTATTPCSSAVRFETGIL 3409
            ||:|||.|||:|:|||.|..|.:.|    ...|.:|:|:|:..|.||:|||||...|||||||::
  Rat  3123 EVIQKVSGGEQPIPLWNEHDGTTDG----DKPKILLYSLNLQFKGIQVTATTPSMRAVRFETGLI 3183

  Fly  3410 ELQLSNRVK---NLGDMSNRKLFFKAHIDFNLSLGQIIRNVIFDEAEPEFQQYAFFHTTINLRNA 3471
            ||:||||::   :.|..|..|||.|..:|.||:||||:::.:::||..:|.|.|:|.|.|.||||
  Rat  3184 ELELSNRLQTKASPGSSSYLKLFGKCQVDLNLALGQIVKHQVYEEAGSDFHQVAYFKTRIGLRNA 3248

  Fly  3472 FQDELL-NEDKELILLTLKRPLVYVQPIAVDKAILVWLNYKNAYEYWAEKRANLCHEHAQHSLLS 3535
            .::|:. :.|:|.:|:||.||:||.||:|.|:|:|.|||||.||:.|.|:|..|           
  Rat  3249 LREEISGSSDREAVLITLNRPIVYAQPVAFDRAVLFWLNYKAAYDNWNEQRMAL----------- 3302

  Fly  3536 QYSGQHQNQNMQNPQVFDRV-AFGQIAGSNLSTLFLQLTVEDMGICLPLKQVNTTTFGSRSYQDF 3599
                 |::.:|...:|.|.: ...|.:.....||||||||.|:|||||:    |.|..|....|.
  Rat  3303 -----HKDIHMATKEVVDMLPGIQQTSAQAFGTLFLQLTVNDLGICLPI----TNTAQSNHTGDL 3358

  Fly  3600 DAKGAVVITLENTIISACNSGALVSKGKFQGLCLRFADDFETNLDDWKPN-SAEPIMNVCVVSEG 3663
            |...|:|:|:|:|:|:||:|.:|||||.|:..|:||||.|||:.|||||. ..:.:||.|||.:|
  Rat  3359 DTGSALVLTIESTLITACSSESLVSKGHFKNFCIRFADGFETSWDDWKPEIRGDLVMNACVVPDG 3423

  Fly  3664 TFEVCSRTT---AAKKGENAKWLLNVKWQMEGVDIHLDVNIGKQLSSLGHTLTMLTGFE------ 3719
            |:|||||||   ||:......|.|||.|:|.|:|:|:|.||||:|::||:|||.|||.|      
  Rat  3424 TYEVCSRTTGQAAAESSSAGTWTLNVLWKMCGIDVHMDPNIGKRLNALGNTLTTLTGEEDIDDIA 3488

  Fly  3720 ------------EDETQMESP--------DSDEGD------------------------------ 3734
                        |||....||        .|..||                              
  Rat  3489 DLNSVNIADLSDEDEVDTMSPTIHTSSDGSSVSGDGHKLTFGQRLVNHLLGLAPPNQRYSVPAEY 3553

  Fly  3735 -----------------QSCR-------DTFVRRRGDFDNLPAFVFDPTIDSKKRSFMME----K 3771
                             ::||       ....||:|...:.|.       :.:.|..|..    :
  Rat  3554 LCDSEMRGSPQASQAHLKACRAHSWGNEAVDYRRQGTSSSQPG-------EPRGRKIMKRLVDIR 3611

  Fly  3772 EMAEQLKIINDLRTLGASHNTVAHEERRLQELQAICYKYFRRDMIQKWKRPSLR-RSLK------ 3829
            |:.||.|:|:||:.||||..|:..|.:|.|:|:::.....|||:.:|.:|.|:| .|||      
  Rat  3612 ELNEQAKVIDDLKKLGASEGTINQEIQRYQQLESVAVNDIRRDVRKKLRRSSMRAASLKDKWGLG 3676

  Fly  3830 ---TYGRSHSYIGSG--------SSVSGVG----VPQTLDNVSYTGRRL-----DTIASNDEISS 3874
               :|.||.|...||        .:.|.:|    :|:...:.:..|.|:     ||:.:....||
  Rat  3677 YKPSYSRSKSISASGRPPLKRMERASSRIGETDELPEIRVDAASPGPRVTFNIQDTLKNTVWGSS 3741

  Fly  3875 LQST------------------------PASCHSRSA------SLKHTTGGGVIGGGVNALGRVT 3909
            .||:                        |:...|.|.      |...||||        ....|.
  Rat  3742 PQSSSPGEGYFQFPEETELDLLSVTIEGPSHYSSNSEGSCSVFSSPKTTGG--------FSPSVP 3798

  Fly  3910 F--TEAMRQTSLPNADTDTETADNE-------------------------------LDWRGDITP 3941
            |  .:..|..||.:...|:|..:.:                               |..|...||
  Rat  3799 FQSEDGRRDDSLSSTSEDSEKDEKDEDREREKFYIYRKPSHTSRKKATGFAAVHQLLTERWPTTP 3863

  Fly  3942 SEIDVDGTSVEMRRKHGHGQKQPEPNIDFELDIKVLVNSGKCVLHT-------KDTGEERGYAGG 3999
            ....:.||:.|.             ||||||||:|.::|||||||.       .|....|.|...
  Rat  3864 VNRSLSGTATER-------------NIDFELDIRVEIDSGKCVLHPTTLLQEHDDISLRRSYDRS 3915

  Fly  4000 SGAATSGVPASSVKSHKREKSIGNDWGSPT--------PSRRQRDKSKLRYNANALLADLTIFHI 4056
            |.:.....|:       ::|....::.|.|        ||..|...|.|         :.|:|:|
  Rat  3916 SRSLDQDSPS-------KKKKFQTNYASTTHLMTGKKVPSSLQTKPSDL---------ETTVFYI 3964

  Fly  4057 PGLDVKLHYQSKTL-------------------AEQLTG-------------------------- 4076
            ||:||||||.||||                   ..:|.|                          
  Rat  3965 PGVDVKLHYNSKTLKTESPNASRGSSLPRTLSKESKLYGMKDNAASPSSPPLPCTVQSKTNTLLP 4029

  Fly  4077 ---DQLPTGRRMGS---KRATLCAWMTLQSIPEETIISPHILEFLEQTLEPIP----ARQSSSVP 4131
               ..:|:.:..||   |.|.|.||:.|||:|||.:|||.:|:|||:.||.||    .|..::|.
  Rat  4030 PQPPPIPSAKGKGSGGVKTAKLYAWVALQSLPEEMVISPCLLDFLEKALETIPITPIERNYTAVS 4094

  Fly  4132 -----------PTPSHNTGVNLDILPANYVTYASFPVDVIVYFHMQPSTFRFSCLPVSRVECMLQ 4185
                       |.|...:..:|  :.::...|:||||||:||..:|||..:|||||||||||||:
  Rat  4095 SQDEDMGHFDIPDPMEESTTSL--VSSSTSAYSSFPVDVVVYVRVQPSQIKFSCLPVSRVECMLK 4157

  Fly  4186 LPSLDIVFSSKR------------------SSEEENSAQ--------PGG-----------HTQP 4213
            |||||:||||.|                  ||..::.|:        ||.           |:..
  Rat  4158 LPSLDLVFSSNRGELETLGTTYPAETLSPGSSAPQSGAKTSASKAGMPGSSGLGSPLGRSRHSSS 4222

  Fly  4214 DQQLPTG------GLSVTGCLADFNVFIFHPYG-GKKTSKETQFSPLS------DSE------RK 4259
            ...| ||      |||.|.|::||::::||||| ||:.|..:..:|.|      |.|      ||
  Rat  4223 QSDL-TGSSSSSSGLSFTACMSDFSLYVFHPYGAGKQKSTVSGLTPGSGGLGNVDEEPTSVTGRK 4286

  Fly  4260 DSLSINVEFVKFHITRCRK----VYIEPLPSSKRSLDQSRAVIRFSTIVDIGSASFKYDMRRLTE 4320
            ||||||:||||..::|.|:    .:.|....||.|......:|..|.:.||||||||||||||:|
  Rat  4287 DSLSINLEFVKVSLSRIRRSGGASFSESQSVSKSSSKMDTTLINISAVCDIGSASFKYDMRRLSE 4351

  Fly  4321 ILAFPKAWYRRRIVRRLFLGDLSVQQQQQQQQGNGAETPTGCPPATPTPNEDASR--AKDNMRLD 4383
            |||||:|||||.|.|||||||.:|            ..||. .|.||...|..|:  :.::.|..
  Rat  4352 ILAFPRAWYRRSIARRLFLGDQTV------------NLPTS-GPGTPDSIEGVSQHLSPESSRKA 4403

  Fly  4384 FD---GQPSQQ----------------------------QQQLGHFGAVRHLKNLGKSS-----S 4412
            :.   .||||.                            .|.|....::|. :::..||     |
  Rat  4404 YCRTWDQPSQSASFTHMPQSPNVFSEHMTNNTMSPGTAAAQSLKSPASIRS-RSVSDSSVPRRDS 4467

  Fly  4413 AESSGTPPSEKN-----QITAWETLVIFAVNFTKLNVQMNIGNVCGNVVWLTKDFQSDGRLSIGS 4472
            ...:.||.::.|     |.|.|||||:||:|..:||||||:.||.||..|.|...:|.||||:||
  Rat  4468 ISKTSTPVNKSNKAASQQGTPWETLVVFAINLKQLNVQMNMSNVMGNTTWTTSGLKSQGRLSVGS 4532

  Fly  4473 TGYKNMYAGIYLGGSALDAKGGIVGGSFEVNKINKRFHIKEEAGMEPYHTMGLSFMALELRLDYM 4537
            ...:.:...:.||.|.||:|||:|||:.:||.:....||.|....:|.|.:.::..:.|.|:|||
  Rat  4533 NRDREISMSVGLGRSQLDSKGGVVGGTIDVNALEMVAHISEHPNQQPNHKIQITMGSTESRVDYM 4597

  Fly  4538 GTSVLMTRISSFSAAMKDEWR----TASQAAATPAHGKDQPRALIFIHGDLTWDQLQIMISKSTT 4598
            |:|:||...|:....::|||:    .|..::.|       .::.||:||||.||..|:|||:|||
  Rat  4598 GSSILMGIFSNADLKLQDEWKVNFYNALDSSMT-------DKSEIFVHGDLKWDIFQVMISRSTT 4655

  Fly  4599 ADLLKMYFKLEEFFTQQFKSSKRVFSNL--EPRLQDRTASIKRRQQHKKKPANGELVAPPQIHGM 4661
            .||:|:..||:|||||||.:|||..|..  .|.|..:|.:     .:.:|.:..:|:        
  Rat  4656 PDLIKIGMKLQEFFTQQFDTSKRALSTWGPVPYLPPKTVT-----NNLEKNSQEQLL-------- 4707

  Fly  4662 IGENTDARHHRHWQKPLAQAVGLVVPSLVTRLPRHGNVLGGTVELRGQNISLACFHGINFKSKSW 4726
                 ||.|||||...|....|..:......||..|...||::.|.|.:::||||||.||:||||
  Rat  4708 -----DAAHHRHWPGVLKVVSGCHISLFQVPLPEDGMQFGGSMSLHGNHMTLACFHGPNFRSKSW 4767

  Fly  4727 ALFSLRSPSINFATEARQ------SEDEVLVTQTLTSSLGQTTEVQQ---QQNHSMAIVSRITR- 4781
            |||.|..|:|.|.|||::      |:....:.|||...||..|.|.:   .....||.:::||| 
  Rat  4768 ALFHLEEPNIAFWTEAQKIWEDGSSDHSTYIVQTLDFHLGHNTMVTKPCGALESPMATITKITRR 4832

  Fly  4782 ---NIIFPPQ-FKTLNEWFHYAFA--NSEIDAVDRFPMLECEREIASNSIERTRASGSSSAAK-- 4838
               |   ||. ..::.|||:|..|  |.|::.:         |.:.:|:.|.:....:||...  
  Rat  4833 RHEN---PPHGVASVKEWFNYVTATRNEELNLL---------RNVDANNSENSTTVKNSSLLSGF 4885

  Fly  4839 --AQEHNHNREVIFALPSLQLHFKTEHKQGPTTPEPSVLCSIAENKPEVLCSFITEFDDHIFVTV 4901
              ...:||..|.|||||.:||.||:.|.|.|  .|||:  ..|..||:|.||.:|||.|||.||:
  Rat  4886 RGGSSYNHETETIFALPRMQLEFKSIHVQEP--QEPSL--QDANVKPKVECSVVTEFTDHICVTM 4946

  Fly  4902 DADAFFFLHDLITSYVTEKEKVIGAQSARAASPNLSQKANLKPYLTDEILKEKKGASNTNLTAQG 4966
            ||:...|||||:::|:.||||.|  ...|..|....||.   |.:..:                 
  Rat  4947 DAELIMFLHDLVSAYLKEKEKAI--FPPRILSTRPGQKC---PVIIQD----------------- 4989

  Fly  4967 KQTSGSKNSLDPLQGSHTSLANAAANMSGAATTNTTTTTTATTLSPGAAAGGPSTSATNDSVDGK 5031
             ..|..::..|.:                          |.||:                     
  Rat  4990 -DNSSDRDREDGI--------------------------TYTTV--------------------- 5006

  Fly  5032 QQQQEGSPPTFDLESFVRDWRHFECQTWHLEPTVRLLSWAGKSIEPYGVDYILNKLGFSHARTTI 5096
                              |||.|.|.|||||||:||:||.|:.|:|.||||||.||||.||||||
  Rat  5007 ------------------DWRDFMCNTWHLEPTLRLISWTGRKIDPVGVDYILQKLGFHHARTTI 5053

  Fly  5097 PKWLQRGFMDPLDKVQALMMLQLLLMVRENKVERDSGASGSGKQQQQN 5144
            |||||||.|||||||.::::.:|...:::.|.::       ||.::::
  Rat  5054 PKWLQRGVMDPLDKVLSVLIKKLGTALQDEKEKK-------GKDKEEH 5094

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tweekNP_001286002.1 FSA_C 4415..5113 CDD:287455 271/728 (37%)
RGD1307100XP_017446228.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C370790312
eggNOG 1 0.900 E1_KOG3596
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D49261at33208
OrthoFinder 1 1.000 FOG0003423
OrthoInspector 1 1.000 T1089276
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31640
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.