DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and KAP114

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_011273.1 Gene:KAP114 SGDID:S000003210 Length:1004 Species:Saccharomyces cerevisiae

Alignment Length:894 Identity:178/895 (20%)
Similarity:327/895 (37%) Gaps:251/895 (28%)


  Fly     1 MEVTEANLQLLAGYLQQTLSADPNVRRPAE-KLLE--STELQQNYPILLLNLIDKAQMDMTTRVA 62
            |::.|    |:.|    ..|||.:.|..|| :||:  .::..|.:. .|.|:..:.:..:.:|..
Yeast     1 MDINE----LIIG----AQSADKHTREVAETQLLQWCDSDASQVFK-ALANVALQHEASLESRQF 56

  Fly    63 GAIAFKNYIKRNWAAHLDSDGPDRIHESD-RNTIKTLIVTLML--HSPVALQKQLSDAVSIIGKY 124
            ..::.:..|...|:...:|.......|.| ::.|:.:::.|.|  :....::...|..:..|...
Yeast    57 ALLSLRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISAV 121

  Fly   125 DFPKKWPQLI-----------------------DEMV--ERFASGD---------FNVINGVLQT 155
            |||.:||||:                       |::|  |.|..|.         |.|:|....|
Yeast   122 DFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVLNTETST 186

  Fly   156 ------AHSLFKRYRYEFKSQALWEEI---KFVLDRMAKPLTDLLQATMQLTKVHENNAGAL--- 208
                  |..|.|....:..|...::|.   .||    ::.|...||...||..::..|...:   
Yeast   187 LIAKIAALKLLKACLLQMSSHNEYDEASRKSFV----SQCLATSLQILGQLLTLNFGNVDVISQL 247

  Fly   209 ---KVIYGSLVLVNKVFFSLN-SQDLPEFFE-------DNINTWMGAFIQQLAADVPSLRTADDE 262
               .:||.:||.:...|...: |.:|.:.|:       :|: |.:.|.::...:: |.|.|..|.
Yeast   248 KFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENV-THINANVETTESE-PLLETVHDC 310

  Fly   263 DAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELLVKTSLHTK------YDSLVSHAL 321
            ...::|.|     .::|......:|     |.:.:|:: .:|.:.|..|:      :::.||...
Yeast   311 SIYIVEFL-----TSVCTLQFSVEE-----MNKIITSL-TILCQLSSETREIWTSDFNTFVSKET 364

  Fly   322 QFLSVVADRQHYQSIF---ENPEILAQICDKVVIPNLDIRPSDEEIFEDSPEEYIRR-------D 376
            ...:....|......|   .||::  .:..|||..:::....:....|..  .|:.:       :
Yeast   365 GLAASYNVRDQANEFFTSLPNPQL--SLIFKVVSNDIEHSTCNYSTLESL--LYLLQCILLNDDE 425

  Fly   377 IEGSDIDTRRRAACDLVKTL-----SINFEQKIFGIFGQYLERLLTKYKENPATNWRSKDTAIYL 436
            |.|.:||...:.   |:|||     |....:.|.......:.|:|.|:                 
Yeast   426 ITGENIDQSLQI---LIKTLENILVSQEIPELILARAILTIPRVLDKF----------------- 470

  Fly   437 VTSWASRGGTQKHGITQTSELVPLPE-FCAQQIIPELERPNINEFPVLKAA---AIKYVMVFR-- 495
                          |....::.||.. |.|:.:...|:    ::..::|:|   |..|...|.  
Yeast   471 --------------IDALPDIKPLTSAFLAKSLNLALK----SDKELIKSATLIAFTYYCYFAEL 517

  Fly   496 -SILGPQV--------------------------LASCLPQLIRHLPAESSVVHS-----YAACS 528
             |:|||:|                          |...|.|:|.:.|.|.   ||     .|...
Yeast   518 DSVLGPEVCSETQEKVIRIINQVSSDAEEDTNGALMEVLSQVISYNPKEP---HSRKEILQAEFH 579

  Fly   529 VEKILSMRDASNAIVFGPQILAPYTTELISGLFATLSLPGSGENEYVMKAIMRSFSVLQS----- 588
            :...:|..|.:|.     |::. .:.|.:..|...:::  .....|:...:....:||.|     
Yeast   580 LVFTISSEDPANV-----QVVV-QSQECLEKLLDNINM--DNYKNYIELCLPSFINVLDSNNANN 636

  Fly   589 -AAMPFMGVALPRLTEILTQVAKNPSRP-QFNHYLFETLALCIKIVCHADSS-----AVSSFEEA 646
             ...|.:.:.|..:|..|.:...:...| :.|.||||.||   |::..:...     |..:|...
Yeast   637 YRYSPLLSLVLEFITVFLKKKPNDGFLPDEINQYLFEPLA---KVLAFSTEDETLQLATEAFSYL 698

  Fly   647 LFPVFQGILQQDIVEFMPYVFQMLSVLLEMREGTGTIPEPYWALFPCLLSPALWDRTGNVTPLIR 711
            :|......::..:::.|..:.::||  ||:.:                 |.|:     ||.|   
Yeast   699 IFNTDTRAMEPRLMDIMKVLERLLS--LEVSD-----------------SAAM-----NVGP--- 736

  Fly   712 LISAFIKQGSAQIQAL-GKLSGILGIFQKMIASKANDHEGFYLLQNLLS 759
            |:.|...:.|.:||.| |::  :..:..::|.::....|     |||||
Yeast   737 LVVAIFTRFSKEIQPLIGRI--LEAVVVRLIKTQNISTE-----QNLLS 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 16/82 (20%)
Cse1 159..528 CDD:285678 85/445 (19%)
CAS_CSE1 530..966 CDD:281384 50/244 (20%)
KAP114NP_011273.1 IBN_N 21..97 CDD:281761 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.