DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and ipo11

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001039123.1 Gene:ipo11 XenbaseID:XB-GENE-494941 Length:975 Species:Xenopus tropicalis

Alignment Length:1132 Identity:233/1133 (21%)
Similarity:390/1133 (34%) Gaps:327/1133 (29%)


  Fly     1 MEVTEAN---LQLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVA 62
            |::..|:   ||:|.    |..|.|..|.:|||:.|:..|.|..:..:|||:.....:|:..|..
 Frog     1 MDLNSASGVVLQVLT----QASSQDSAVLKPAEEQLKQWETQPGFYTVLLNIFTNHSLDVNVRWL 61

  Fly    63 GAIAFKNYIKRNWAAHLDSDGPDRIHESDRNTIKTLIVTLMLHSPV-ALQKQLSDAVSIIGKYDF 126
            ..:.|||.|.|.|.    ...|..:.|.::.|::..::| ..:.|| .:..|::..::.:.:.|.
 Frog    62 AVLYFKNGIDRYWR----RVAPHALSEEEKATLRAGLIT-NFNEPVNQIATQIAVLIAKVARLDC 121

  Fly   127 PKKWPQLIDEMVERFASGDFNVINGVLQTAHSLFKRYRYEFKSQALWEEIKFVLDRMAKPLTDLL 191
            ||:||:||..::|.....|                                           ||.
 Frog   122 PKQWPELIPTLIESVKIQD-------------------------------------------DLR 143

  Fly   192 QATMQLTKVHENNAGALKVIYGSLVLVNKVFFSLNSQDL-PEFFEDNINTW---MGAFIQQL--- 249
            |....||..|     ..|.:....:..::..|    ||| .|.:....:.|   ...|:||:   
 Frog   144 QHRALLTFYH-----VTKTLSSKRLAADRKLF----QDLASEIYSFTCSLWNHHTDTFLQQICSG 199

  Fly   250 --AADVPSL-RTADDEDA-------GVLE-HLRAQV----------------------CENICLY 281
              .|.:.|| ||......       |.|| |..|.|                      .||:|  
 Frog   200 GETAAINSLERTLLSLKVLRKLTVHGFLEPHQNADVTGFLLAVFVRLKQFLDCSRNIGAENVC-- 262

  Fly   282 AKKYDEEFKPFMEQFVTAVWELLVKTSLHTKYDSLVSHALQF-LSVVADRQHYQSIFENPEILAQ 345
                .|..:..:..|...:.:.|.:..:  .:..|:..:|:| :|.|........:||...:...
 Frog   263 ----RERLEKIIILFTKVLLDFLDQHPI--SFIPLIQRSLEFAVSYVFTEAGDGIVFERFIVQCM 321

  Fly   346 ICDKVVIPNLDIRPSDEEIFEDSPEEYIRRDIEGSDIDTRRRAACDLVKTLSINFEQKIFGIF-- 408
            ...|:::......||..  ||||..|                         :||..|.....|  
 Frog   322 SLIKMIVKEDSYIPSKN--FEDSKPE-------------------------TINAHQIKLSFFTH 359

  Fly   409 ---GQYLERLLTKY---KENPATNWRSKDTAIYLVTSWASRGGTQKHGITQTSELVPLPEF--CA 465
               .:...||:|.|   .:.....| .:|...:.|..  :.|.:.|:.:...||::.:..|  .:
 Frog   360 QTLTEICRRLVTHYFILSDEELAMW-EEDPEGFAVEE--TGGDSWKYSLRPCSEVLFIDIFHEYS 421

  Fly   466 QQIIPELERPNINEFPVLKAAA---------IKYVMVFRSI-LGPQVLASCL-------PQLIRH 513
            :.:.|.|    :|....:|...         ||.. |:.:: |....|..|:       .||:  
 Frog   422 ETLTPVL----LNMVDTIKGPTCVEDLNTLRIKET-VYNAVGLAAYELFDCIDFDEWFQSQLL-- 479

  Fly   514 LPAESSVVHSYAACSVEKILSMRDASNAIVFGPQILAPYTTELISGLFATLSLPGSGENEYVMKA 578
              .|..|.|........:::.:.....::.|... |.|...|.|..|.....|....|....:|.
 Frog   480 --GELQVAHDRYKLLRRRVIWLIGQWISVKFKAD-LRPLLYEAILSLLQDPDLVVRIETATTLKL 541

  Fly   579 IMRSFSVLQSAAMPFMGVALPRLTEILTQVAKNPSRPQFNHYLFETLALCIKIVCHADSSAVSSF 643
            .:..|.......:|::......|.::|.||.:..|:.|               |.|..|..:...
 Frog   542 TVDDFEFRTEQFLPYLETTFSLLFQLLQQVTECDSKMQ---------------VLHVLSCVIERV 591

  Fly   644 EEALFPVFQGILQQDIVEFMPYVFQ-----------MLSVLLEMREGTGTIPEPYWALFPCLL-- 695
            ...:.| |.|.|    |:::|.:::           :||.|:.:.:|.|...|   .|:|.||  
 Frog   592 NMQIRP-FVGCL----VQYLPLLWKQSEEHNMLRCAILSTLVHLIKGLGGSSE---NLYPFLLPV 648

  Fly   696 --------SP----------ALW----DRTGNVTP-LIR---------------------LISAF 716
                    .|          .||    :...:||| |:|                     :|:|:
 Frog   649 IQLSTDVSQPPHVYLLEDGLELWLVTLENCSSVTPELLRIFHNMAALLELSSENLLICFKIINAY 713

  Fly   717 IKQGSA---QIQALGKLSGILGIFQKMIASKANDHEG----FYLLQNLLSYYP---PAEIQTNLR 771
            |...|:   ||.|.......|.:.:.:      .:||    ..:::|:|...|   |...|..|.
 Frog   714 IFSSSSEFLQIYAANLCQAFLELLRDI------TNEGQVQVLKVVENVLKVNPAVGPQMFQALLP 772

  Fly   772 QIFGLLFQRLSLSKTPKYLS---GII--------IFFSFYVIKFSGSQMAQLIDEIQPNLFGMLL 825
            .:|..:.:.   .|.|..:|   ||:        ..||..:.:.|.....: .|:|..||..|.:
 Frog   773 PVFRGIIEG---EKYPVVMSTYLGILGRVLLQNQCCFSSLLYQLSQEYNCE-PDQILGNLIEMWV 833

  Fly   826 DRVFITEMGKIPKEQDRKMVAVGVTKLLTETPEILQQQYATFWPRLLHSLIDLFERPPE-----K 885
            ||     |..|.:.:.||:.|:.:..||.....|:|.::.......:.||.|:....||     .
 Frog   834 DR-----MDNITQPERRKLSALALLSLLPSANSIIQDKFCGIINVCVESLHDVMTEDPETSTYKD 893

  Fly   886 LMGLEIGETAGVAEDPDAGYQVAFAQLTHAQPNQQD---HLAEIKD------ARQFLATSLSKFA 941
            .|.:...|...|.||.:             .|.:||   .:..:||      .:||:...| |..
 Frog   894 CMLMSHLEDPQVIEDEE-------------PPTEQDKRKKMLALKDPVHAVSLQQFVYEKL-KAQ 944

  Fly   942 QARAGE--FSTLLSPLEPEYKQVLQKY 966
            |...||  |.:|:..::.|....||::
 Frog   945 QELLGEEGFRSLMETVDTEIVTQLQEF 971

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 20/76 (26%)
Cse1 159..528 CDD:285678 79/437 (18%)
CAS_CSE1 530..966 CDD:281384 112/530 (21%)
ipo11NP_001039123.1 CSE1 10..>681 CDD:227944 158/803 (20%)
IBN_N 28..100 CDD:281761 20/77 (26%)
HEAT repeat 515..545 CDD:293787 6/30 (20%)
HEAT repeat 552..586 CDD:293787 10/49 (20%)
HEAT repeat 599..630 CDD:293787 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.