DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and Ranbp9

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001287284.1 Gene:Ranbp9 FlyBaseID:FBgn0037894 Length:1018 Species:Drosophila melanogaster

Alignment Length:1118 Identity:213/1119 (19%)
Similarity:391/1119 (35%) Gaps:328/1119 (29%)


  Fly     9 QLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAIAFKNYIKR 73
            |.:...||..||:|..|.:..||.::..|..:.|.:.|..:|.....::..|....:....|::.
  Fly    15 QAIIEELQNLLSSDTGVLQQTEKRIKQLEYTEGYGVYLSEIIMNQAHELPLRQIAIVMLTRYVEN 79

  Fly    74 NWAAHLDSDGPDR------IHESDRNTIKTLIVTLMLHSPVALQKQLSDAVSIIGKYDFPKKWPQ 132
            :|.   |.|...|      ..|..:.||:.::...:......::..::..:|.|...|:|..|.:
  Fly    80 HWT---DDDDVKRKANGCMASEQAKRTIRNILPNGLYDPNSKIRSSVAHTISTIAATDYPHCWAE 141

  Fly   133 LIDEMVERFASGDFNVINGVLQTAHSLFKRYRYEFK-----SQALWEEIKFVLD----------- 181
            |.| ::.:...|:.:.|:|.:|    :.:.:.|:.:     ...:..|:..:.|           
  Fly   142 LFD-IIVKCLGGNEDSIHGAMQ----VLQDFSYDVEQIKELGPVVIPEVYRIFDSEQNYSIKTRV 201

  Fly   182 ---RMAKPLTDLLQATMQLTKVHENNAGALKVIYGSLVLVNKV-----FFSLNSQDLPEFFEDNI 238
               |:.|||...:.|.  :|...|.:.      ..|.:|.|.:     :.|:||..:..|.    
  Fly   202 SAIRILKPLFASIAAL--ITNKEEQST------MMSSILTNFMDKLMHYLSMNSGAVSSFL---- 254

  Fly   239 NTWMGAFIQQLAADVPSLRTADDEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWEL 303
                             |||   |...|..||..::        .||   ..|||::.:..||:|
  Fly   255 -----------------LRT---EIIKVFTHLVNEM--------PKY---INPFMDRVLPIVWQL 288

  Fly   304 L-------VKTSLH------------------TKYDSLVSHALQFLSVVADRQHYQSIFENPEIL 343
            |       ||.|::                  |.:.||:...|:|::.:......:...:|  :|
  Fly   289 LTQIAETYVKVSVNQTETSPLASGDSEEDDEQTNFQSLIIQILEFINCILTCNKLRGSIKN--VL 351

  Fly   344 AQICDKVVIPNLDIRPSDEEI--FEDSPEEYIRRDIEGSDIDTRRRAACDLVKTLSINFEQKIFG 406
            |   |.:.|..:.|:.|:|::  :.|.||:::..:.:|....|.|....|::  |:||.|     
  Fly   352 A---DLIYITIVYIQLSEEQLEDWHDDPEKFVDDEDDGGVELTVRMCGRDVL--LAINDE----- 406

  Fly   407 IFG----QYLERLLTKY-----KENPATN---WRSKDT---AIYLVTSWASRGGTQKHGITQTSE 456
             ||    |.|:..|.::     .|..|.|   |:.::.   |::........|.:       |.:
  Fly   407 -FGANAIQPLQEALGRHFSVADAEKAANNPNWWKIQEACMDAVHAFRDVILAGDS-------TFD 463

  Fly   457 LVPLPEFCAQQIIPELERPNINEFPVLKAAAIKYVMVF--RSILGPQVLASCLPQLIRHL-PAES 518
            |:.........::.:       |.|.|...|:..:.::  ..:..||:|...|...:..| |.:|
  Fly   464 LLNYLTIVRNLLVHQ-------ESPPLVGRALWTLSIYSKSDLYNPQMLTEILDVTLCSLSPEKS 521

  Fly   519 SVVHSYAACSVEKILSMRDASNAIVFGPQ--ILAPYTTELISGLFATLSLPGSGENEYVMKAIMR 581
            .::...|..::...|.    :|..:.|.:  :|.......:.|:.|.  :|||  ...|:..:|.
  Fly   522 HILRISAVRTLNGFLQ----ANETIDGEKRTLLVSKLPGFLDGIMAL--VPGS--KAAVLALLME 578

  Fly   582 --SFSVLQSAAMPFMGVA--LPRLTEILTQVAKNPSRPQFNHYLFETLALCIKIVCHADSSAVSS 642
              :|.|...|...|...|  .|....:..:..::|       |:.||:...||.:|.. ...:..
  Fly   579 ALTFMVKFDAEFAFASQAKITPLAIAVFLKYTEDP-------YVLETVQDLIKALCQR-KECLGP 635

  Fly   643 FEEALFPVFQGIL---------QQDIVEFMPYVFQMLSVLLEMRE---GTGTIPEPYWALFPCLL 695
            .:|...|....||         :|||      ...:|:.::...|   ....:...:.|:..|:|
  Fly   636 LQEKFIPTIVSILGLTGAASTEKQDI------ALDVLNTIVRYTEPPLNNSLLETAFPAIINCVL 694

  Fly   696 ---SPALWDRTG-------NVTP--------------LIRLISAFI------------KQGSAQI 724
               ..|:....|       ||:|              ::::::..:            :.|...|
  Fly   695 HTDDHAVMVAGGECLRSFINVSPEQICSYKNGEGINCIMQVVATVLLNPMNSEMTAAGQIGRLVI 759

  Fly   725 QALGKLSGILG----IFQKMIASKANDHEGFYLLQNLLSYYPPAEIQTNLRQIFGLLFQRL---- 781
            ..:.|:..:||    :..|.:.||..:.|...::.||:                 |:|..|    
  Fly   760 TIITKMGSMLGQNVDMLLKAVISKMQNLECLKVIMNLV-----------------LIFAHLFLTQ 807

  Fly   782 ------SLSKTP-------------KYLSGIIIFFSFYVIKFSGSQMAQLIDEIQPNLFGML--- 824
                  .||..|             .:||....||..|..|.:...:.:|.:      :|:.   
  Fly   808 MDAVLNFLSTVPGPNGEPAMQFVLTNWLSRQNSFFGNYERKVTTMALCKLFE------YGVATQD 866

  Fly   825 --LDRVFITEMGKIPKEQDRKMVAVGVT-------KLLTETPEILQQQYATFW------------ 868
              |..:...|:...|.:..|:..:|..|       ..|.:..::|..:|..|.            
  Fly   867 NRLTTITFKELVDDPTDTRRRTRSVAATTQKWVTIPALVKIFKVLISEYQHFQEGKSDEPLTDSE 931

  Fly   869 --------------PRLLHSLIDLFE-----RPPEKLMGLEIGET--AGVAEDPDAGYQVAFAQL 912
                          ||.:.   ||||     ...|:|:...:.||  .|...|....:...|.|.
  Fly   932 EDGDDEDAPGNPDKPRYIS---DLFESDEDNAEDEQLLQELLKETNYQGDIADNLQKFLTTFTQN 993

  Fly   913 THAQPNQQDHLAE 925
            .|. |...:||.|
  Fly   994 EHF-PTFYEHLTE 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 15/82 (18%)
Cse1 159..528 CDD:285678 85/438 (19%)
CAS_CSE1 530..966 CDD:281384 95/523 (18%)
Ranbp9NP_001287284.1 SXM1 14..891 CDD:227943 188/999 (19%)
IBN_N 36..114 CDD:281761 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112380048
eggNOG 1 0.900 E1_COG5657
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10997
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.