DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and ipo9

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_998704.1 Gene:ipo9 ZFINID:ZDB-GENE-040426-2953 Length:1043 Species:Danio rerio

Alignment Length:1150 Identity:212/1150 (18%)
Similarity:415/1150 (36%) Gaps:314/1150 (27%)


  Fly     2 EVTEANLQLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAIA 66
            :|.:...:.|...|...||....||..||:.::..|:.:.:.:.|..|.......:..|...::.
Zfish    17 QVDKGLKETLIDALNAILSPVQEVRAAAEERIKVLEVTEEFGVHLAELTVDPHGALAIRQLASVI 81

  Fly    67 FKNYIKRNWAAHLDSDGPDRIHESDRNTIKTLIVTLMLHSPVALQKQLSDAVSIIGKYDFPKKWP 131
            .|.|::.:|.|..:...|....|..:..|:.|:.:.:..:...::..::.|:|.|..:|:|:.||
Zfish    82 LKQYVETHWCARSEKYRPPETTEWAKAAIRELLPSGLREAISKVRSSVAYALSAIAHWDWPEAWP 146

  Fly   132 QLIDEMVERFASGDFNVINGVLQTAHSLFKRYRYEFKSQALWEEIKFVLDRMAKPLTDL----LQ 192
            .|...:::..||||.|.::|.::    :...:..|.....:.:....:|.:|.|..|..    ::
Zfish   147 GLFKLLMDMLASGDVNAVHGAMR----VLTEFTREVTDVQMPDVAPVILPQMYKIFTMAEVYSIR 207

  Fly   193 ATMQLTKVHENNAGAL----KVIYGSLVLVNKVFFSLNSQDLPEFFEDNINTWMGAFIQQLAADV 253
            ...:..::....|..:    :|..|:   .|.:.|.:    :.:|.|        ||||  |..:
Zfish   208 TRSRAVEIFTTCANLICAIDEVAKGA---ANALIFPV----VQQFTE--------AFIQ--ALQI 255

  Fly   254 PSLRTADDEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELL-------VKTSL-H 310
            |...|:|       ..|:.:|.:.:....|.:.:.....|:|.:..||..|       |:|.: :
Zfish   256 PDGPTSD-------SGLKMEVLKAVTALVKNFPKPMVSSMQQILPIVWNTLTESASFYVRTEVNY 313

  Fly   311 TK--------------YDSLVSHALQFLSVVADRQHYQSIFEN--PEILAQICDKVVIPNLDIRP 359
            |:              :::||....:|:..:.:.:.::|..:.  ||::..|     |..:.|..
Zfish   314 TEEVDDPVDSDGEVLGFENLVFSIFEFVHTLLENKKFKSTVKKALPELIYYI-----ILYMQITE 373

  Fly   360 SDEEIFEDSPEEYIRRDIEGSDIDT----RRRAACDLVKTLSINFEQKIFGIFGQYLERLLTKYK 420
            ...:::..:|:::    :|..|.||    .|.:|.||:..::..|:.:..........|.|.:.:
Zfish   374 DQIKVWTANPQQF----VEDEDDDTFSYSVRISAQDLLLAVAAEFQNESAAALAAAATRHLQEAE 434

  Fly   421 ENPATN----WRSKDTAIY-------LVTSWASRGGTQ--KHGITQTSELVPLPEFCAQQIIPEL 472
            :...|.    |:..:..:.       ::|.....|..|  .||            |.|..|:.:|
Zfish   435 QAKNTGSEHWWKVHEACMLALGSVKTIITENVKNGRVQFDMHG------------FLANVILADL 487

  Fly   473 ERPNINEFPVLKAAAIKYVMVFRSILGPQVLASCLPQLIRHLPAESSVVHSYAACSVEKI----- 532
            ..|..:  |.|...|:.....|.:.:.|:::...|...:..|  ..|...|....:|..|     
Zfish   488 NLPAAS--PFLLGRALWAASRFTAAMSPELIQQFLQATVSGL--HESQPPSVRISAVRAIWGYCD 548

  Fly   533 -LSMRDASNAI-VFGPQIL-------APYTTELISGLFATLSL-----PG---SGENEY------ 574
             |.:.::::.: .|.|.:|       |.:::|:::.:..||.:     |.   |.||:.      
Zfish   549 QLKLSESTHVLQPFLPSVLEGLVQLAAQFSSEVLTLVMETLCIVCTVDPAFTTSAENKICPLTIA 613

  Fly   575 -------------VMKAIMRSFSVLQSAAMPFMGVALPRLT-------------------EILTQ 607
                         :.:.|.:..:.:::...|.....:|.|.                   :|||.
Zfish   614 IFLKYSNDPVVASLAQDIFKELAQIEACQGPMQMRLIPTLVSIMQAPPDKIPSGLCATSIDILTT 678

  Fly   608 VAKNPSRPQFNHYLFETLALCIKIVCHA------------DSSAVSSFEEALFPVFQGILQQDIV 660
            |.:|...|           |...:||.|            |::.:.:..|.| ..:..:..:.|.
Zfish   679 VVRNTKPP-----------LSDMLVCQAFPAVAQCTLRTDDNTTMQNGGECL-RAYVSVALEQIA 731

  Fly   661 EFMP--------YVFQMLSVLLEMREGTGTIPEPYWALFPCLLSPALWDRTGNVTPLIRLISAFI 717
            .:..        ||.|::|.||:.|....|      |.|                 :.||:|..|
Zfish   732 RWQDEQGHSGLWYVMQVVSQLLDPRTSEFT------AAF-----------------VGRLVSTLI 773

  Fly   718 KQGSAQIQALGKLSGILGIFQKMIASKANDHEGFYLLQNLLSYYPPAEIQTNLRQIFGLLFQRLS 782
            .:...|:  ..:|..||    :.|.||....|...::|:|:..:... :.:.|..:...|.....
Zfish   774 TRAGTQL--ADQLDQIL----RAILSKMQQAETLSVMQSLIMVFAHL-VHSQLEPLLEFLCSLPG 831

  Fly   783 LSKTP-------KYLSGIIIFFSFYVIKFSGSQMAQLIDE-IQPN---LFGMLL--DRVFITEMG 834
            .:..|       :::|...:|:..|..|.|...:.:|:.. :..|   |..:::  |.:|..:.|
Zfish   832 PTGKPALEFVMAEWMSRQHLFYGQYEGKVSAVALCKLLQHGLNTNDKRLQDIVVKGDEIFNPDEG 896

  Fly   835 --------KIPKEQDRKMVAVGVTKLLTE-------------TPEILQQQYATFWPRLLHSLIDL 878
                    :.|:......:.|.:.||:..             .|....|.....|.       ||
Zfish   897 ICTRSKSAENPQRWTNIPLLVKIFKLIVNELSSVVEANANRANPADWSQDSGGMWD-------DL 954

  Fly   879 FERPPEKLMGLEIGETAGVA-----------------------EDPDAGYQVAFAQLTHAQPNQQ 920
            .|...|:      .|..|:|                       |||||               .:
Zfish   955 AEEEDEE------EEDEGLAGQLLSDLIASNKYDDDYYEDDDDEDPDA---------------LK 998

  Fly   921 DHLAEIKDARQFLATSLSKFAQARA-GEFSTLLSPLEPEYKQVLQ 964
            |.:.:| |.:.:|...|::|||... ..||:.|:.:|   ::|||
Zfish   999 DPIFQI-DLQAYLTDFLTQFAQQPCYSMFSSHLNEVE---RRVLQ 1039

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 14/76 (18%)
Cse1 159..528 CDD:285678 73/418 (17%)
CAS_CSE1 530..966 CDD:281384 103/573 (18%)
ipo9NP_998704.1 CSE1 35..814 CDD:227944 160/873 (18%)
IBN_N 44..118 CDD:197981 14/74 (19%)
HEAT repeat 518..545 CDD:293787 6/29 (21%)
HEAT repeat 563..589 CDD:293787 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.