DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and Cse1l

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001102077.1 Gene:Cse1l RGDID:1307536 Length:971 Species:Rattus norvegicus

Alignment Length:983 Identity:505/984 (51%)
Similarity:691/984 (70%) Gaps:22/984 (2%)


  Fly     1 MEVTEANLQLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAI 65
            ||:::||||.|..||::||..||.:||||||.|||.|..||||:|||.|::|:| |...:|..::
  Rat     1 MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQ-DNVIKVCASV 64

  Fly    66 AFKNYIKRNWAAHLDSDGPDRIHESDRNTIKTLIVTLMLHSPVALQKQLSDAVSIIGKYDFPKKW 130
            .|||||||||  .:..|.|::|.|:||..||..||.|||.||..:|||||||:||:|:.|||:||
  Rat    65 TFKNYIKRNW--RIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIVGREDFPQKW 127

  Fly   131 PQLIDEMVERFASGDFNVINGVLQTAHSLFKRYRYEFKSQALWEEIKFVLDRMAKPLTDLLQATM 195
            |.|:.|||.||.||||:||||||:||||||||||:||||..||.|||.|||..|.|||:|.:||:
  Rat   128 PDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATI 192

  Fly   196 QLTKVHENNAGALKVIYGSLVLVNKVFFSLNSQDLPEFFEDNINTWMGAFIQQLAADVPSLRTAD 260
            :|...|.|:|.||::::.||:|::|:|:|||.||||||||||:.|||..|...|..|...|:|.|
  Rat   193 ELCSTHANDASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMNNFHTLLTLDNKLLQTDD 257

  Fly   261 DEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELLVKTSLHTKYDSLVSHALQFLS 325
            :|:||:||.|::|:|:|..|||:||||||:.::.:||||:|.|||.|....|||.|||:|:|||:
  Rat   258 EEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNLLVTTGQEVKYDLLVSNAIQFLA 322

  Fly   326 VVADRQHYQSIFENPEILAQICDKVVIPNLDIRPSDEEIFEDSPEEYIRRDIEGSDIDTRRRAAC 390
            .|.:|.||:::||:...|..||:||::||::.|.:|||.|||:.|||||||:|||||||||||||
  Rat   323 SVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAAC 387

  Fly   391 DLVKTLSINFEQKIFGIFGQYLERLLTKYKENPATNWRSKDTAIYLVTSWASRGGTQKHGITQTS 455
            |||:.|...||..:.|||..|:..:|.:|.:||:.||:.||.|||||||.||:..||||||||.:
  Rat   388 DLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNPSVNWKHKDAAIYLVTSLASKAQTQKHGITQAN 452

  Fly   456 ELVPLPEFCAQQIIPELERPNINEFPVLKAAAIKYVMVFRSILGPQVLASCLPQLIRHLPAESSV 520
            |||.|.||....|:|:|:..|:||||||||..|||:|:||:.:..:.|...:|.||.||.|||.|
  Rat   453 ELVNLTEFFVNHILPDLKSNNVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLISHLGAESIV 517

  Fly   521 VHSYAACSVEKILSMRDASNAIVFGPQILAPYTTELISGLFATLSLPGSGENEYVMKAIMRSFSV 585
            ||:|||.::|::.:||..:||.:|....:||:...|::.||..|:||||.||||:|||||||||:
  Rat   518 VHTYAAHALERLFTMRGPNNATLFTAAEIAPFVGILLTNLFKALTLPGSSENEYIMKAIMRSFSL 582

  Fly   586 LQSAAMPFMGVALPRLTEILTQVAKNPSRPQFNHYLFETLALCIKIVCHADSSAVSSFEEALFPV 650
            ||.|.:|::...:.:||:.|..|:||||:|.||||:||.:.|.|:|.|.|:.:||.:||||||.|
  Rat   583 LQEAIIPYIPTLITQLTQKLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLV 647

  Fly   651 FQGILQQDIVEFMPYVFQMLSVLLEMREGTGTIPEPYWALFPCLLSPALWDRTGNVTPLIRLISA 715
            |..|||.|:.||:|||||::|:|||..:  ..||..|.||||.||.|.||:|.||:..|:||:.|
  Rat   648 FTEILQNDVQEFIPYVFQVMSLLLETHK--NDIPSSYMALFPHLLQPVLWERAGNIPALVRLLQA 710

  Fly   716 FIKQGSAQI--QALGKLSGILGIFQKMIASKANDHEGFYLLQNLLSYYPPAEIQTNLRQIFGLLF 778
            |:::||:.|  .|..|:.|:||:|||:||||||||:|||||.:::.:.||..:....:|||.|||
  Rat   711 FLERGSSTIATAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLF 775

  Fly   779 QRLSLSKTPKYLSGIIIFFSFYVIKFSGSQMAQLIDEIQPNLFGMLLDRVFITEMGKIPKEQDRK 843
            |||..|||.|::...::|.:.|.||:....:.::.|.|||.:|||:|:::.|.|:.|:....::|
  Rat   776 QRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK 840

  Fly   844 MVAVGVTKLLTETPEILQQQYATFWPRLLHSLIDLFERP-----PEKLMGLEIGETAGVAEDPDA 903
            :.|||:||||||.|.::..:|...|..||.|||.|||.|     |::...::|.:|        .
  Rat   841 ICAVGITKLLTECPAMMDTEYTKLWTPLLQSLIGLFELPEDDSIPDEEHFIDIEDT--------P 897

  Fly   904 GYQVAFAQLTHAQPNQQDHLAE-IKDARQFLATSLSKFAQARAGEFSTLLS-PLEPEYKQVLQKY 966
            |||.||:||..|...:.|.:.: :.:.|..||.:|.:.:.|..|...:::| .|..|..|.||.|
  Rat   898 GYQTAFSQLAFAGKKEYDPVGQTVNNPRVHLAQALHRLSTACPGRVPSMVSTSLNAEALQYLQGY 962

  Fly   967 CDQAGVRI 974
            ...|.|.:
  Rat   963 LQAASVTL 970

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 41/76 (54%)
Cse1 159..528 CDD:285678 209/369 (57%)
CAS_CSE1 530..966 CDD:281384 198/445 (44%)
Cse1lNP_001102077.1 IBN_N 29..102 CDD:197981 41/76 (54%)
Cse1 156..525 CDD:285678 209/369 (57%)
CAS_CSE1 527..962 CDD:281384 198/445 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C149044471
eggNOG 1 0.900 E1_COG5657
Hieranoid 1 1.000
Homologene 1 1.000 H1006
Inparanoid 1 1.050 989 1.000 Inparanoid score I284
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004308
OrthoInspector 1 1.000 T1089251
orthoMCL 1 0.900 OOG5_128085
Panther 1 1.100 LDO PTHR10997
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.