DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and Ipo9

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_722469.1 Gene:Ipo9 MGIID:1918944 Length:1040 Species:Mus musculus

Alignment Length:1095 Identity:206/1096 (19%)
Similarity:394/1096 (36%) Gaps:258/1096 (24%)


  Fly     5 EANLQLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAIAFKN 69
            ||.:..|.|    .||....||..||:.::..|:.:.:.:.|..|....|..:..|...::..|.
Mouse    23 EALVDTLTG----ILSPVQEVRAAAEEQIKVLEVTEEFGVHLAELTVDPQGALAIRQLASVILKQ 83

  Fly    70 YIKRNWAAHLDSDGPDRIHESDRNTIKTLIVTLMLHSPVALQKQLSDAVSIIGKYDFPKKWPQLI 134
            |::.:|.|..:...|....|..:..|:.|:...:..|...::..::.|||.|..:|:|:.||||.
Mouse    84 YVETHWCAQSEKFRPPETTERAKIVIRELLPNGLRESISKVRSSVAYAVSAIAHWDWPEAWPQLF 148

  Fly   135 DEMVERFASGDFNVINGVLQTAHSLFKRYRYEFKSQALWEEIKFV----LDRMAKPLT------- 188
            :.::|...|||.|.::|.:        |...||..:....::..|    |..|.|..|       
Mouse   149 NLLMEMLVSGDLNAVHGAM--------RVLTEFTREVTDTQMPLVAPVILPEMYKIFTMAEVYGI 205

  Fly   189 --------DLLQATMQLTKVHENNAGALKVIYGSLVLVNKVFFSLNSQDLPEFFEDNINTWMGAF 245
                    ........:..:.|...||.||:...:|              .:|.|        ||
Mouse   206 RTRSRAVEIFTTCAHMICNMEELEKGAAKVLIFPVV--------------QQFTE--------AF 248

  Fly   246 IQQLAADVPSLRTADDEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELL------ 304
            :|  |..:|...|:|       ...:.:|.:.:....|.:.:.....|:|.:..||..|      
Mouse   249 VQ--ALQMPDGPTSD-------SGFKMEVLKAVTALVKNFPKHMVSSMQQILPIVWNTLTESAAF 304

  Fly   305 -VKTSL-HTK--------------YDSLVSHALQFLSVVADRQHYQSIFEN--PEILAQICDKVV 351
             |:|.: :|:              :::||....:|:..:.:...::|..:.  ||::..|     
Mouse   305 YVRTEVNYTEEVEDPVDSDGEVLGFENLVFSIFEFVHALLENSKFKSTVKKALPELIYYI----- 364

  Fly   352 IPNLDIRPSDEEIFEDSPEEYIRRDIEGSDIDTRRRAACDLVKTLSINFEQKIFGIFGQYLERLL 416
            |..:.|.....:::..:|::::..:.:.:...|.|.||.||:..::.:|:.:..........|.|
Mouse   365 ILYMQITEEQIKVWTANPQQFVEDEDDDTFSYTVRIAAQDLLLAVATDFQNESAVALATAATRHL 429

  Fly   417 TKYKENPATN----WRSKDTAIY-------LVTSWASRGGT--QKHGITQTSELVPL-------- 460
            .:.::..|:.    |:..:..:.       ::|.....|..  ..||......||.|        
Mouse   430 QEAEQTKASGTEHWWKIHEACMLALGSVKSIITDSVKNGRIHFDMHGFLTNVILVDLNLSASPFL 494

  Fly   461 ----------------PEFCAQQIIPELERPNINEFPVLKAAAIKYVMVFRSIL----GPQVLAS 505
                            ||...|.:...:...:..:.|.::.:|::.:..:...|    ...||..
Mouse   495 LGRALWAASRFTVAMSPELIQQFLQATVSGLHETQPPSVRISAVRAIWGYCDQLKVSESTHVLQP 559

  Fly   506 CLPQLIR---HLPAESS------VVHSYA-ACSVEKILSMRDASNAIVFGPQILAPYTTE----- 555
            .||.::.   ||.|:.|      |:.:.. .|:|:...:....:....|...|...|:.:     
Mouse   560 FLPSILDGLIHLAAQFSSEVLNLVMETLCIVCTVDPEFTASVENKICPFTIAIFLKYSNDPVVAS 624

  Fly   556 LISGLFATLSLPGSGENEYVMKAIMRSFSVLQSAAMPFMGVALPRLTEILTQVAKNPSRPQFNHY 620
            |...:|..||...:.:....|:.|....|::|:.|............:|||.|.:| ::|..:..
Mouse   625 LAQDIFKELSQIEACQGPMQMRLIPTLVSIMQAPADKIPAGLCATAIDILTTVVRN-TKPPLSQL 688

  Fly   621 L----FETLALCIKIVCHADSSAVSSFEEALFPVFQGILQQDIVEF--------MPYVFQMLSVL 673
            |    |..:|.|   ..|.|.:|...........:..:..:.:.::        :.||.|::|.|
Mouse   689 LICQAFPAVAQC---TLHTDDNATMQNGGECLRAYVSVTLEQVAQWHDEQGHNGLWYVMQVVSQL 750

  Fly   674 LEMREGTGTIPEPYWALFPCLLSPALWDRTGNVTPLIRLISAFIKQGSAQIQALGK-LSGILGIF 737
            |:.|....|      |.|                 :.||:|..|.:...:   ||: |..||   
Mouse   751 LDPRTSEFT------AAF-----------------VGRLVSTLISKAGRE---LGENLDQIL--- 786

  Fly   738 QKMIASKANDHEGFYLLQNLLSYYPPAEIQTNLRQIFGLLFQRLSLSKTP-------KYLSGIII 795
             :.|.||....|...::|:|:..:... :.|.|..:...|......:..|       ::.|...:
Mouse   787 -RAILSKMQQAETLSVMQSLIMVFAHL-VHTQLEPLLEFLCSLPGPTGKPALEFVMAEWTSRQHL 849

  Fly   796 FFSFYVIKFSGSQMAQLI------DEIQPNLFGMLLDRVFITEMG--------KIPKEQDRKMVA 846
            |:..|..|.|...:.:|:      |:.:.....:..:.::..:.|        |.|:......:.
Mouse   850 FYGQYEGKVSSVALCKLLQHGINADDKRLQDIRVKGEEIYSMDEGIRTRSKSAKNPERWTNIPLL 914

  Fly   847 VGVTKL-LTETPEILQ-----QQYATFWPRLLHSLIDLFERPPEK------LMGLEIGETAGVA- 898
            |.:.|| :.|...:::     |.....|.:  ....|::|...|:      |.|..:.:....: 
Mouse   915 VKILKLIINELSNVMEANAARQATPAEWNQ--DDSNDMWEDQEEEEEEEDGLAGQLLSDILATSK 977

  Fly   899 -----------EDPDAGYQVAFAQLTHAQPNQQDHLAEIKDARQFLATSLSKFAQ 942
                       :||||               .:|.|.:| |.:.:|...|.:|||
Mouse   978 YEEDYYEDDEEDDPDA---------------LKDPLYQI-DLQAYLTDFLCQFAQ 1016

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 15/76 (20%)
Cse1 159..528 CDD:285678 77/463 (17%)
CAS_CSE1 530..966 CDD:281384 88/477 (18%)
Ipo9NP_722469.1 SXM1 22..900 CDD:227943 180/960 (19%)
IBN_N 43..117 CDD:197981 15/74 (20%)
HEAT repeat 420..459 CDD:293787 4/39 (10%)
HEAT repeat 469..508 CDD:293787 5/39 (13%)
HEAT repeat 516..543 CDD:293787 3/27 (11%)
HEAT repeat 561..587 CDD:293787 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.