DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and Cse1l

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_076054.1 Gene:Cse1l MGIID:1339951 Length:971 Species:Mus musculus

Alignment Length:983 Identity:507/984 (52%)
Similarity:692/984 (70%) Gaps:22/984 (2%)


  Fly     1 MEVTEANLQLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAI 65
            ||:::||||.|..||::||..||.:||||||.|||.|..||||:|||.|::|:| |...:|..::
Mouse     1 MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQ-DNVIKVCASV 64

  Fly    66 AFKNYIKRNWAAHLDSDGPDRIHESDRNTIKTLIVTLMLHSPVALQKQLSDAVSIIGKYDFPKKW 130
            .|||||||||  .:..|.|::|.|:||..||..||.|||.||..:|||||||:||||:.|||:||
Mouse    65 TFKNYIKRNW--RIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGREDFPQKW 127

  Fly   131 PQLIDEMVERFASGDFNVINGVLQTAHSLFKRYRYEFKSQALWEEIKFVLDRMAKPLTDLLQATM 195
            |.|:.|||.||.||||:||||||:||||||||||:||||..||.|||.|||..|.|||:|.:||:
Mouse   128 PDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATI 192

  Fly   196 QLTKVHENNAGALKVIYGSLVLVNKVFFSLNSQDLPEFFEDNINTWMGAFIQQLAADVPSLRTAD 260
            :|...|.|:|.||::::.||:|::|:|:|||.||||||||||:.|||..|...|..|...|:|.|
Mouse   193 ELCSTHANDASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMNNFHTLLTLDNKLLQTDD 257

  Fly   261 DEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELLVKTSLHTKYDSLVSHALQFLS 325
            :|:||:||.|::|:|:|..|||:||||||:.::.:||||:|.|||.|....|||.|||:|:|||:
Mouse   258 EEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNLLVTTGREVKYDLLVSNAIQFLA 322

  Fly   326 VVADRQHYQSIFENPEILAQICDKVVIPNLDIRPSDEEIFEDSPEEYIRRDIEGSDIDTRRRAAC 390
            .|.:|.||:::||:...|..||:||::||::.|.:|||.|||:.|||||||:|||||||||||||
Mouse   323 SVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAAC 387

  Fly   391 DLVKTLSINFEQKIFGIFGQYLERLLTKYKENPATNWRSKDTAIYLVTSWASRGGTQKHGITQTS 455
            |||:.|...||..:.|||..|:..:|.:|.:||:.||:.||.|||||||.||:..||||||||.:
Mouse   388 DLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNPSVNWKHKDAAIYLVTSLASKAQTQKHGITQAN 452

  Fly   456 ELVPLPEFCAQQIIPELERPNINEFPVLKAAAIKYVMVFRSILGPQVLASCLPQLIRHLPAESSV 520
            |||.|.||....|:|:|:..|:||||||||..|||:|:||:.:..:.|...:|.||.||.|||.|
Mouse   453 ELVNLTEFFVNHILPDLKSNNVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLISHLEAESIV 517

  Fly   521 VHSYAACSVEKILSMRDASNAIVFGPQILAPYTTELISGLFATLSLPGSGENEYVMKAIMRSFSV 585
            ||:|||.::|::.:||.::|..:|....:||:...|::.||..|:||||.||||:|||||||||:
Mouse   518 VHTYAAHALERLFTMRGSNNTTLFTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSL 582

  Fly   586 LQSAAMPFMGVALPRLTEILTQVAKNPSRPQFNHYLFETLALCIKIVCHADSSAVSSFEEALFPV 650
            ||.|.:|::...:.:||:.|..|:||||:|.||||:||.:.|.|:|.|.|:.:||.:||||||.|
Mouse   583 LQEAIIPYIPTLITQLTQKLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLV 647

  Fly   651 FQGILQQDIVEFMPYVFQMLSVLLEMREGTGTIPEPYWALFPCLLSPALWDRTGNVTPLIRLISA 715
            |..|||.|:.||:|||||::|:|||..:  ..||..|.||||.||.|.||:||||:..|:||:.|
Mouse   648 FTEILQNDVQEFIPYVFQVMSLLLETHK--NDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQA 710

  Fly   716 FIKQGSAQI--QALGKLSGILGIFQKMIASKANDHEGFYLLQNLLSYYPPAEIQTNLRQIFGLLF 778
            |:::||:.|  .|..|:.|:||:|||:||||||||:|||||.:::.:.||..:....:|||.|||
Mouse   711 FLERGSSTIATAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLF 775

  Fly   779 QRLSLSKTPKYLSGIIIFFSFYVIKFSGSQMAQLIDEIQPNLFGMLLDRVFITEMGKIPKEQDRK 843
            |||..|||.|::...::|.:.|.||:....:.::.|.|||.:|||:|:::.|.|:.|:....::|
Mouse   776 QRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK 840

  Fly   844 MVAVGVTKLLTETPEILQQQYATFWPRLLHSLIDLFERP-----PEKLMGLEIGETAGVAEDPDA 903
            :.|||:||||||.|.::..:|...|..||.|||.|||.|     |::...::|.:|        .
Mouse   841 ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDSIPDEEHFIDIEDT--------P 897

  Fly   904 GYQVAFAQLTHAQPNQQDHLAE-IKDARQFLATSLSKFAQARAGEFSTLLS-PLEPEYKQVLQKY 966
            |||.||:||..|...:.|.:.: :.:.:..||.||.|.:.|..|...:::| .|..|..|.||.|
Mouse   898 GYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGY 962

  Fly   967 CDQAGVRI 974
            ...|.|.:
Mouse   963 LQAASVTL 970

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 41/76 (54%)
Cse1 159..528 CDD:285678 209/369 (57%)
CAS_CSE1 530..966 CDD:281384 199/445 (45%)
Cse1lNP_076054.1 IBN_N 29..102 CDD:197981 41/76 (54%)
Cse1 156..525 CDD:285678 209/369 (57%)
CAS_CSE1 527..962 CDD:281384 199/445 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C149046726
eggNOG 1 0.900 E1_COG5657
Hieranoid 1 1.000
Homologene 1 1.000 H1006
Inparanoid 1 1.050 993 1.000 Inparanoid score I301
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004308
OrthoInspector 1 1.000 T1085709
orthoMCL 1 0.900 OOG5_128085
Panther 1 1.100 LDO PTHR10997
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4827
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.