DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and cse1l

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_012827002.1 Gene:cse1l XenbaseID:XB-GENE-5802331 Length:1007 Species:Xenopus tropicalis

Alignment Length:980 Identity:507/981 (52%)
Similarity:683/981 (70%) Gaps:23/981 (2%)


  Fly     1 MEVTEANLQLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAI 65
            ||::|||||.|..||::||..||.|||||||.|||.|..||||:|||.|::::| |...:|..|:
 Frog    37 MELSEANLQGLTEYLKKTLDPDPAVRRPAEKYLESVEGNQNYPLLLLTLVERSQ-DNVIKVCSAV 100

  Fly    66 AFKNYIKRNWAAHLDSDGPDRIHESDRNTIKTLIVTLMLHSPVALQKQLSDAVSIIGKYDFPKKW 130
            .|||||||||  .:..|.|:.|.|:||..||:.|:.|||.||..:|||.|||:||||:.|||:||
 Frog   101 TFKNYIKRNW--RIIEDEPNNICEADRIAIKSSIINLMLSSPEQIQKQFSDAISIIGREDFPQKW 163

  Fly   131 PQLIDEMVERFASGDFNVINGVLQTAHSLFKRYRYEFKSQALWEEIKFVLDRMAKPLTDLLQATM 195
            |.|:.|||.||.||||:||||||.||||||||||:||||..||.|||.|||..|.|||||.:||:
 Frog   164 PNLLTEMVNRFQSGDFHVINGVLHTAHSLFKRYRHEFKSSELWTEIKLVLDTFAAPLTDLFKATI 228

  Fly   196 QLTKVHENNAGALKVIYGSLVLVNKVFFSLNSQDLPEFFEDNINTWMGAFIQQLAADVPSLRTAD 260
            :|...|.|:..||||::.||:|:.|:|.|||.||||||||||:.|||..|...|..|...|:|.|
 Frog   229 ELCNTHANDVNALKVLFSSLILIAKLFHSLNFQDLPEFFEDNMETWMTNFHNLLTLDNKLLQTDD 293

  Fly   261 DEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELLVKTSLHTKYDSLVSHALQFLS 325
            :|:||:||.|::|:|:|..|||:||||||:|::.:||||:|.|||.|....|||.|||:|:|||:
 Frog   294 EEEAGLLETLKSQICDNAALYAQKYDEEFQPYLPRFVTAIWNLLVTTGQEVKYDLLVSNAIQFLA 358

  Fly   326 VVADRQHYQSIFENPEILAQICDKVVIPNLDIRPSDEEIFEDSPEEYIRRDIEGSDIDTRRRAAC 390
            .|.:|.||:::||:|..|..||:||::||::.|.:|||.|||:.|||||||:|||||||||||||
 Frog   359 SVCERPHYKNLFEDPSTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAAC 423

  Fly   391 DLVKTLSINFEQKIFGIFGQYLERLLTKYKENPATNWRSKDTAIYLVTSWASRGGTQKHGITQTS 455
            |||:.|...||..:..||..|:..:|.:|.::|:.||:.||.|||||||.||:..||||||||.:
 Frog   424 DLVRGLCKFFEGPVTNIFSGYVSSMLQEYAKSPSVNWKHKDAAIYLVTSLASKAQTQKHGITQAN 488

  Fly   456 ELVPLPEFCAQQIIPELERPNINEFPVLKAAAIKYVMVFRSILGPQVLASCLPQLIRHLPAESSV 520
            |||.:.||....|:|:|:..||||:|||||..|||:|.|||.|..:.|...:|.||.||.|||.|
 Frog   489 ELVNITEFFVNHILPDLKSANINEYPVLKADGIKYIMFFRSQLPKEQLLVTIPLLIAHLQAESVV 553

  Fly   521 VHSYAACSVEKILSMRDASNAIVFGPQILAPYTTELISGLFATLSLPGSGENEYVMKAIMRSFSV 585
            ||:|||.::|:..:|:.|::..:.....:.||...|::.||..||||||.||||:|||||||||:
 Frog   554 VHTYAAHALERFFTMKGATSPTLIVAAEMMPYVELLLANLFKALSLPGSSENEYIMKAIMRSFSL 618

  Fly   586 LQSAAMPFMGVALPRLTEILTQVAKNPSRPQFNHYLFETLALCIKIVCHADSSAVSSFEEALFPV 650
            ||.|.:|::...:.:||:.|..|:||||:|.|||||||.:.|.|:|.|.|:.:||.|||:|||.|
 Frog   619 LQEAIIPYIPSVISQLTQKLLAVSKNPSKPHFNHYLFEAICLSIRITCRANPAAVGSFEDALFLV 683

  Fly   651 FQGILQQDIVEFMPYVFQMLSVLLEMREGTGTIPEPYWALFPCLLSPALWDRTGNVTPLIRLISA 715
            |..|||.|:.||:|||||::|:|||:.  ...||..|.||||.||.|.||:||||:.||:||:.|
 Frog   684 FTEILQSDVQEFIPYVFQVMSLLLEIH--ANDIPTSYMALFPHLLQPVLWERTGNIPPLVRLLQA 746

  Fly   716 FIKQGSAQI--QALGKLSGILGIFQKMIASKANDHEGFYLLQNLLSYYPPAEIQTNLRQIFGLLF 778
            ::::|:..|  .|..|:.|:||:|||:||||||||:|||||.:::.:.|...|:...||||.:||
 Frog   747 YLERGANTIAASASDKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHLPAECIEQYKRQIFIVLF 811

  Fly   779 QRLSLSKTPKYLSGIIIFFSFYVIKFSGSQMAQLIDEIQPNLFGMLLDRVFITEMGKIPKEQDRK 843
            |||..|||.|::...::|.:.:.|||....:.::.|.|||.:|||:::::.|.|:.|:....::|
 Frog   812 QRLQSSKTTKFVKSFLVFLNLFCIKFGAIALQEMFDSIQPKMFGMVVEKIIIPEIQKVSGPIEKK 876

  Fly   844 MVAVGVTKLLTETPEILQQQYATFWPRLLHSLIDLFERP-----PEKLMGLEIGETAGVAEDPDA 903
            :.|||:||:|||.|.::..:|...|..||.:||.|||.|     |:....::|.:|        .
 Frog   877 ICAVGLTKVLTECPAMMDTEYTKLWTPLLQALIGLFELPEDDTIPDDEHFIDIEDT--------P 933

  Fly   904 GYQVAFAQLTHAQPNQQDHLAE-IKDARQFLATSLSKFAQARAGEFSTLLS-PLEPEYKQVLQKY 966
            |||.||:||..|...:.|.:.| :.:.:..||.||.|.:.|..|...:::| .|..:..|.||.|
 Frog   934 GYQAAFSQLAFAGKKEHDPIGEMVNNPKILLAQSLHKLSTACPGRVPSMISTSLNADALQFLQGY 998

  Fly   967 CDQAG 971
            . |||
 Frog   999 L-QAG 1002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 40/76 (53%)
Cse1 159..528 CDD:285678 212/369 (57%)
CAS_CSE1 530..966 CDD:281384 195/445 (44%)
cse1lXP_012827002.1 IBN_N 65..138 CDD:197981 40/76 (53%)
Cse1 192..561 CDD:285678 212/369 (57%)
CAS_CSE1 563..998 CDD:281384 195/445 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C149039303
eggNOG 1 0.900 E1_COG5657
Hieranoid 1 1.000
Homologene 1 1.000 H1006
Inparanoid 1 1.050 979 1.000 Inparanoid score I289
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004308
OrthoInspector 1 1.000 T1061635
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4827
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.