DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cse1 and ipo9

Sequence 1:NP_523588.2 Gene:Cse1 FlyBaseID:FBgn0022213 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001090647.1 Gene:ipo9 XenbaseID:XB-GENE-5960761 Length:1034 Species:Xenopus tropicalis

Alignment Length:1133 Identity:215/1134 (19%)
Similarity:401/1134 (35%) Gaps:293/1134 (26%)


  Fly     5 EANLQLLAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAIAFKN 69
            ||.|..|.|    .||....||..||:.|:..|:.:.:.:.|..|....|..:..|...::..|.
 Frog    18 EALLDTLNG----ILSPGHEVRAAAEEQLKVLEVTEEFGVHLAELTVDPQGALAIRQLASVILKQ 78

  Fly    70 YIKRNWAAHLDSDGPDRIHESDRNTIKTLIVTLMLHSPVALQKQLSDAVSIIGKYDFPKKWPQLI 134
            |::.:|.:..:........|..:..|:.|:.|.:..|...::..::.|||.|..:|:|:.||||.
 Frog    79 YVENHWCSQSEKFRLPETTERAKTAIRQLLPTGLRESISKVRSSVAYAVSAIAHWDWPEAWPQLF 143

  Fly   135 DEMVERFASGDFNVINGVLQTAHSLFKRYRYEFKSQALWEEIKFVLDRMAKPLTDL---LQATMQ 196
            :.::|...||:.|.::|.::                        ||....:.:||.   |.|.:.
 Frog   144 NILMEMLVSGEVNAVHGAMR------------------------VLTEFTREVTDTQMPLVAPVI 184

  Fly   197 LTKVHENNAGALKVIYGSLV--------------------LVNKVFFSLNSQDLPEFFEDNINTW 241
            |.::::  ...:..:||...                    |...|..:|....:.:|.|      
 Frog   185 LPEMYK--IFTMSEVYGIRTRSRAVEIFTTCAHMICTMEELEKGVAHALIFPVVQQFTE------ 241

  Fly   242 MGAFIQQLAADVPSLRTADDEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELL-- 304
              ||:|  |..:|...|:|       ..|:.:|.:.:....|.:.:.....|:|.:..||..|  
 Frog   242 --AFVQ--ALQMPDGPTSD-------SGLKMEVLKAVTALVKNFPKHMVSSMQQILPIVWNTLTE 295

  Fly   305 -----VKTSLHTK---------------YDSLVSHALQFLSVVADRQHYQSIFEN-PEILAQICD 348
                 |:|.::..               :::||....:|:..:.|.:...::.:. ||::..|  
 Frog   296 SAAFYVRTEVNDTEDIEDPVDSDGEVLGFENLVFSIFEFVHTLLDSKFKGTVKKALPELIYYI-- 358

  Fly   349 KVVIPNLDIRPSDEEIFEDSPEEYIRRDIEGSDIDTRRRAACDLVKTLSINFEQKIFGIFGQYLE 413
               |..:.|.....:::..:|::::..:.:.:...|.|.||.||:..:|..|:.:..........
 Frog   359 ---ILYMQITEEQIKVWTANPQQFVEDEDDDTFSYTVRIAAQDLLLAVSSEFQNESAVALAAAAT 420

  Fly   414 RLL---TKYKENPATNWRSKDTAIYL--------VTSWASRGGTQ--KHGITQTSELVPL----- 460
            |.|   .:||.....:|.....|..|        :|.....|..|  .||......|..|     
 Frog   421 RHLQEAEQYKAQGGEHWWKIHEACMLALGSVKSVITEGVQSGRVQFDMHGFLTGVILSDLNLSVS 485

  Fly   461 -------------------PEFCAQQIIPELERPNINEFPVLKAAAIKYVMVFRSIL----GPQV 502
                               ||...|.:...:...:.|:.|.::.:|::.:..:...|    ...|
 Frog   486 PFLLGRSLWAASRFTAAMSPELIQQFLQATVSGLHDNQPPSVRISAVRAIWGYCDQLKISESTHV 550

  Fly   503 LASCLPQLIR---HLPAE--SSVVHSY-----AACSVEKILSMRDASNAIVFGPQILAPYTTE-- 555
            |...||.::.   ||.|:  |.|::..     ..|||:...:....:....|...|...|:.:  
 Frog   551 LQPFLPSVLDGLIHLAAQFTSEVLNLVMETLCIVCSVDPAFTASAEAKICPFTIAIFLKYSNDPV 615

  Fly   556 ---LISGLFATLS-LPGSGENEYVMKAIMRSFSVLQSAAMPFMGVALPRLTEILTQVAKNPSRPQ 616
               |...:|..|: :||. :|...|:.|....|::|:.|............:|||.|.:| ::|.
 Frog   616 VASLAQDIFKELAQIPGC-QNAMQMRLIPTLVSIMQAPAEKIPSGLCATAIDILTTVVRN-TKPP 678

  Fly   617 FNHYL----FETLALCIKIVCHADSSAVSSFEEALFPVFQGILQQDIVEF--------MPYVFQM 669
            .:..|    |..:|.|   ...||.:.:..........:..:..:.:.::        :.||.|:
 Frog   679 LSELLICQAFPAVAQC---TLRADDNTIMQNGGECLRAYVSVALEQVAQWRDEQGHTGLWYVMQV 740

  Fly   670 LSVLLEMREGTGTIPEPYWALFPCLLSPALWDRTG-----NVTPLIRLISAFIKQGSAQIQALGK 729
            :|.||:.|....|      |.|...|...|..:.|     |:..::|.|.:.::|.    :.|..
 Frog   741 VSQLLDPRTSEFT------AAFVGRLVSTLISKAGRELGENLDQILRAILSKMQQA----ETLSV 795

  Fly   730 LSGILGIFQKMIASKANDHEGFYLLQNLLSYYPPAEIQTNLRQIFGLLFQRLSLSKTPKYLSGII 794
            :..::.:|..::.|:...     ||:.|.|...|.          |.......:|   :::|...
 Frog   796 MQSLIMVFAHLVHSQLEP-----LLEFLCSLPGPT----------GKPALEFVMS---EWMSRQH 842

  Fly   795 IFFSFYVIKFSGSQMAQLIDEIQPNLFGMLL------------DRVFITEMG-KIPKEQDRKMVA 846
            :|:..|..|.|...:.:::.      :|:.:            |.:|..|.| :...:..|....
 Frog   843 LFYGQYEGKVSSVALCKILQ------YGITVDDKRLQDIKVKGDEIFNMEEGIRTRSKTSRNPEC 901

  Fly   847 VGVTKLLTETPEILQQQYATF------------W--------PRLLHSLIDLFERPPEKLMGLEI 891
            .....||.:..:::..:.:|.            |        |.      |::|...|:..||  
 Frog   902 WTTIPLLVKMYKLIINELSTVIEANATRNTEDEWIQGNGADDPN------DMWEDEDEEDEGL-- 958

  Fly   892 GETAG--------------------VAEDPDAGYQVAFAQLTHAQPNQQDHLAEIKDARQFLATS 936
               ||                    ..:|||.               .:|.|.:| |.:.:|...
 Frog   959 ---AGQLLSDILSSNKYDDDYYEDDEEDDPDV---------------LKDPLYQI-DLQTYLTDF 1004

  Fly   937 LSKFAQARAGEFSTLLSPLEPEYKQVLQ 964
            |.:|||...  ||.....|....::.||
 Frog  1005 LRQFAQQPC--FSAFSEHLNDNERRTLQ 1030

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cse1NP_523588.2 IBN_N 29..105 CDD:281761 15/76 (20%)
Cse1 159..528 CDD:285678 80/466 (17%)
CAS_CSE1 530..966 CDD:281384 93/512 (18%)
ipo9NP_001090647.1 CSE1 29..806 CDD:227944 161/840 (19%)
IBN_N 38..112 CDD:197981 15/74 (20%)
HEAT repeat 510..537 CDD:293787 4/27 (15%)
HEAT repeat 555..581 CDD:293787 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.