DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and AT1G66130

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_176787.1 Gene:AT1G66130 AraportID:AT1G66130 Length:364 Species:Arabidopsis thaliana

Alignment Length:388 Identity:93/389 (24%)
Similarity:159/389 (41%) Gaps:60/389 (15%)


  Fly    91 TLRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVA-AYQSHALAFAERHQVE----NVYTSFEDL 150
            |:|:|:......|..|...::   |..:.::..:: .....|..||..:.:.    .:|.|:|:|
plant     6 TVRFGLLGCIRFASKFVRTVT---ESSNAVIIAISDPSLETAKTFATGNNLSPETVTIYGSYEEL 67

  Fly   151 AKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEG-MW 214
            ....|||.||::....|.:..........||||.|||......::.|::|.....|:..|:| :|
plant    68 LNDANVDAVYLTMPVTQRARWAVTAAEKKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132

  Fly   215 PRCVPAYHYLRHQILRNR------LGEIKQVHCTLGLPV--------SQGRLGLYGGVTNDFGVY 265
                  .|:.|...:|:.      ||:::.::.|:..||        ::..:||.|.: .:.|.|
plant   133 ------LHHQRTVKIRDTMFDSGLLGDVRHMYSTMTTPVPEQVLERLTKEAMGLAGAI-GELGWY 190

  Fly   266 GMQLALWVFR-EVP---RCLKVSGRVNSEHVDVSADIELCF--TRGKRALIEVSSEKKLSNQAVI 324
            .:..|||... ::|   |.|..|...||....:|....|.|  |....|::..|...:||....|
plant   191 PIGAALWAMSYQMPISVRALPSSVSTNSVGTILSCTASLQFGSTATTTAIVHCSFLSQLSTDLAI 255

  Fly   325 QGKDGSIKMNNYWCPTRLITEEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVR-NCILKGSTES 388
            .|..|||:||:|..|.:    |....|....|.:....|    :|.....|.|. :|  .|:.|:
plant   256 SGSKGSIQMNDYVIPYK----EDKAWFEYTSGAKFVDMH----IGWNVTPERVTVDC--SGTPET 310

  Fly   389 DDFSHNESLLLANLMDTIHAELGV--GEFANRNEVSDLQKQIENVQDIVKDPEELASETCRVV 449
                 .|:::|......:.   |:  |:........|:.|:.:.:.|.||...::.   |.||
plant   311 -----QEAMMLREFTRLVE---GIKRGDLEADRRWPDISKKTQLIVDAVKKSVDIG---CEVV 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 80/323 (25%)
GFO_IDH_MocA 92..213 CDD:279716 30/127 (24%)
AT1G66130NP_176787.1 MviM 4..>262 CDD:223745 66/266 (25%)
GFO_IDH_MocA 7..127 CDD:279716 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2115
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D943656at2759
OrthoInspector 1 1.000 T32103
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.