DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and AT1G34200

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_564441.1 Gene:AT1G34200 AraportID:AT1G34200 Length:352 Species:Arabidopsis thaliana

Alignment Length:348 Identity:83/349 (24%)
Similarity:138/349 (40%) Gaps:39/349 (11%)


  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQS--HALAFAERHQV---ENVYTSFEDLA 151
            :|.|:...:......:.|:::.|   :..:|.:|...|  .|.:||:.:..   ..:::|:|.|.
plant     7 IRIGLLSCTNKVRKLSRAINLSP---NATISAIATTSSIEEAKSFAKSNNFPPNTKLHSSYESLL 68

  Fly   152 KCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEG-MW- 214
            :.|:||.||.......|.|...|.....||:|.:||:.:...:..:::|.....|:..|:| .| 
plant    69 EDPDVDAVYFPIPTRLHVEWATLAAIKGKHILLDKPVALNVAEFDQIVEACEVNGVQFMDGTQWM 133

  Fly   215 --PRCVPAYHYLRHQILRNRLGEIKQVHCTLGLPVSQGRL--------GLYG-GVTNDFGVYGMQ 268
              ||......::..   ....|:||.|:.......|...|        ||.| |...|.|.|.:|
plant   134 HSPRTDKIKEFVND---LESFGQIKSVYSCFSFAASDDFLKHDIRVKPGLDGLGALGDAGWYTIQ 195

  Fly   269 LALWV--FREVPRCLKVSGRV-NSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGS 330
            ..|.|  |:.......:||.| |...:.:|......:..|..|.|..|....|:.:....|..||
plant   196 AILLVNNFKLPKTVTALSGSVLNDAGIVLSCGALFDWEDGVNATIYCSFLANLTMEITAIGTKGS 260

  Fly   331 IKMNNYWCPTRLITEEVDYEFPLPGGDQLPPTHYHNRLGM--CYEAE------EVRNCILKGSTE 387
            ::::::..| .:.||.|   |...||..:........|..  |...|      |::|...|....
plant   261 LRVHDFVIP-YMETEAV---FTTSGGGCVSEHKVMTELSQEACMVMEFARLVGEIKNRGAKPDGF 321

  Fly   388 SDDFSHNESLLLANLMDTIHAEL 410
            ...||.|..||:..:.::|...|
plant   322 WMRFSRNTQLLVDAVKESIDNNL 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 76/324 (23%)
GFO_IDH_MocA 92..213 CDD:279716 30/127 (24%)
AT1G34200NP_564441.1 MviM 6..342 CDD:223745 82/345 (24%)
GFO_IDH_MocA 7..127 CDD:279716 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2115
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D943656at2759
OrthoInspector 1 1.000 T32103
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.