DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and AT4G09670

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_192705.1 Gene:AT4G09670 AraportID:AT4G09670 Length:362 Species:Arabidopsis thaliana

Alignment Length:407 Identity:90/408 (22%)
Similarity:154/408 (38%) Gaps:92/408 (23%)


  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQ-SHALAFAERH---QVENVYTSFEDLAK 152
            :|.|:...:.:|...:.|:.:.|   :..:|.||:.. ..|.|||..:   :...::.|:|.|.:
plant     7 IRIGVMGCADIARKVSRAIHLAP---NATISGVASRSLEKAKAFATANNYPESTKIHGSYESLLE 68

  Fly   153 CPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEG-MW-- 214
            .|.:|.:|:......|.|.........||:|.|||:.|...:..|:::...|.|:.:|:| ||  
plant    69 DPEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAMNVTEFDKIVDACEANGVQIMDGTMWVH 133

  Fly   215 -PRCVPAYHYLRHQILRNRLGEIKQVHCTLGLPVSQGRL--------GLYG-GVTNDFGVYGMQL 269
             ||......:|...   .|.|::|.|.........:..|        ||.| |...|.|.|.::.
plant   134 NPRTALLKEFLSDS---ERFGQLKTVQSCFSFAGDEDFLKNDIRVKPGLDGLGALGDAGWYAIRA 195

  Fly   270 ALWVFR-EVPRCLKV-SGRV-NSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSI 331
            .|.... |:|:.:.. .|.| |...|.:|....|.:..|:.|.|..|....|:.:....|..|::
plant   196 TLLANNFELPKTVTAFPGAVLNEAGVILSCGASLSWEDGRTATIYCSFLANLTMEITAIGTKGTL 260

  Fly   332 KMNNYWCPTR----------------LITEEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNC 380
            :::::..|.:                |:|..|.           ||:.:..:..:..||..||. 
plant   261 RVHDFIIPYKETEASFTTSTKAWFNDLVTAWVS-----------PPSEHTVKTELPQEACMVRE- 313

  Fly   381 ILKGSTESDDFSHNESLLLANLMDTIHAELGVGEFANRNEVSD-----LQKQIENVQDIVKDPEE 440
                              .|.|         |||..|.....|     :.::.:.|.|.||:..:
plant   314 ------------------FARL---------VGEIKNNGAKPDGYWPSISRKTQLVVDAVKESVD 351

  Fly   441 LASETCRVVEDISMGGR 457
                  :..:.||:.||
plant   352 ------KNYQQISLSGR 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 75/331 (23%)
GFO_IDH_MocA 92..213 CDD:279716 32/126 (25%)
AT4G09670NP_192705.1 MviM 6..351 CDD:223745 86/389 (22%)
GFO_IDH_MocA 7..126 CDD:279716 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2115
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D943656at2759
OrthoInspector 1 1.000 T32103
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.