DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and gfod2

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001071214.2 Gene:gfod2 ZFINID:ZDB-GENE-061103-64 Length:367 Species:Danio rerio

Alignment Length:425 Identity:87/426 (20%)
Similarity:155/426 (36%) Gaps:100/426 (23%)


  Fly    82 GVWVVDEGPTLRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTS 146
            ||.|...|.|:|              |.:.:|.::...:.:.....|..|.:.|....:....:.
Zfish     4 GVGVFGTGQTVR--------------ALVPLLQKEGFPVQAVWGRTQEEAESLASELDIPFSTSQ 54

  Fly   147 FEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKAR-ARGLFLM 210
            .:|:...|.|.:|.|....|...::....|...|:|:.|:...:|:  ..|::..|| ...|..:
Zfish    55 TDDVLLHPEVHLVCILTPPPHTRQIAVKALGIGKNVISEQAATLTD--ACKMVTAARYYPQLMSI 117

  Fly   211 EGMWPRCVPAYHYLRHQILRNRLGEIKQVHCTLGLPVSQGRLGLYGG--VTNDFGVYGMQLALWV 273
            .|...|.:||:.:     ::..|||   .:|. .|.|.:.|  :|||  ::..:|        |.
Zfish   118 MGNSLRFLPAFVH-----MKRLLGE---GYCG-SLQVCEAR--VYGGSLLSQSYG--------WA 163

  Fly   274 FREVPRCLKVSG----RVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMN 334
            :.|:     :.|    .|.|..:|:.:.:..|     ||:......:....|....|...|:..:
Zfish   164 WEEL-----MGGGGLHTVGSCIIDLLSHLTGC-----RAVRVHGMLRTFVRQGGPAGGIRSVTAD 218

  Fly   335 NYWCPTRLITE----EVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNCILKGST------ESD 389
            :|.|...|::.    .|...|.|||.|                   |...:|.||:      .::
Zfish   219 DYACFQLLMSGGAVCSVTLNFNLPGTD-------------------VHEIMLVGSSGRLVARGTE 264

  Fly   390 DFSHN-----ESLLLANLMDTIHAEL-GVGEFANRNEVSDLQKQIENVQDIVKDPEELASE---- 444
            .|...     |.|||::..:.....: |:.....:..:| .|.| |:.:...:.|..:|:.    
Zfish   265 LFGQRINMQAEELLLSDGGEATGPSVRGLNSMVTQLRLS-FQAQ-EDRRSWARHPVSMAASFEDG 327

  Fly   445 --TCRVVEDISMGGR-----SLDINRQEVKDQVKH 472
              ...||:.|....|     |:::..|||.....|
Zfish   328 LYVQTVVDAIKRSNRTGEWESVEVKIQEVDPNHNH 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 63/315 (20%)
GFO_IDH_MocA 92..213 CDD:279716 22/122 (18%)
gfod2NP_001071214.2 MviM 5..350 CDD:223745 82/411 (20%)
NADB_Rossmann 5..109 CDD:304358 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.