DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and Dhdh

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_001076463.2 Gene:Dhdh RGDID:1588686 Length:333 Species:Rattus norvegicus

Alignment Length:334 Identity:109/335 (33%)
Similarity:167/335 (50%) Gaps:23/335 (7%)


  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNV 156
            |||||....|:|.||...||.||...|::|:..|...:.|..||:::.:...|.|:|:|||.|.:
  Rat     3 LRWGIVSAGLIASDFTTVLSSLPPSEHQVVAVAARDLNRAEEFAQKYNIPKAYGSYEELAKSPTL 67

  Fly   157 DVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAY 221
            :|.||:..:|||.....|.|...|.||||||:.:...:|.:::.|||::|:||||.:|.|..||.
  Rat    68 EVAYIATQHPQHKPAVLLCLAAGKAVLCEKPMGVNTAEVREMVAKARSQGIFLMEAIWSRFFPAM 132

  Fly   222 HYLRHQILRNRLGEIKQVHCTLGLPVSQ-------GRLGLYGGVTNDFGVYGMQLALWVF-REVP 278
            ..|:..:::..:|:::......|..:|.       .:.|  ||:. |.|:|.:|....|| .:.|
  Rat   133 EALQEVLVQGTIGDLRVARAEFGRDLSSVPRATDWNQAG--GGLL-DLGIYCVQFFSMVFGAQKP 194

  Fly   279 RCLKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMNNYWCPTRLI 343
            ..:...||::...||.:..:.|.:..|.......|....|.|.|.:.|..|..:::..||||.|:
  Rat   195 EKISAVGRIHETGVDDTVSVLLQYPGGLHGSFTCSISSDLPNTAYVNGTKGMAQIDKLWCPTELV 259

  Fly   344 TEEVDYEFPLPGGDQLPPT---HYHNRLGMC--YEAEEVRNCILKGSTESDDFSHNESLLLANLM 403
            ......|||       ||.   .|:...|.|  |||..:|.|:.||..||......||.|||.::
  Rat   260 VNGESKEFP-------PPVLGKEYNFLNGSCMLYEANHIRECLRKGLKESPVVPLAESELLAEIL 317

  Fly   404 DTIHAELGV 412
            :.:...:||
  Rat   318 EEVRKAIGV 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 100/308 (32%)
GFO_IDH_MocA 92..213 CDD:279716 50/121 (41%)
DhdhXP_001076463.2 MviM 1..325 CDD:223745 107/332 (32%)
GFO_IDH_MocA 3..117 CDD:279716 45/114 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234869559
eggNOG 1 0.900 E1_COG0673
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22604
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.